SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009191 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009191
Domain Number 1 Region: 1175-1401
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.1e-40
Family Laminin G-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 329-433
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 224-336
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.0006
Further Details:      
 
Domain Number 4 Region: 640-752
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 5 Region: 116-222
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 6 Region: 537-639
Classification Level Classification E-value
Superfamily Cadherin-like 1.96e-25
Family Cadherin 0.0022
Further Details:      
 
Domain Number 7 Region: 1419-1630
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-25
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 8 Region: 740-857
Classification Level Classification E-value
Superfamily Cadherin-like 7e-25
Family Cadherin 0.00099
Further Details:      
 
Domain Number 9 Region: 12-114
Classification Level Classification E-value
Superfamily Cadherin-like 4.97e-23
Family Cadherin 0.0035
Further Details:      
 
Domain Number 10 Region: 434-535
Classification Level Classification E-value
Superfamily Cadherin-like 3e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 11 Region: 1114-1153
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000243
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 12 Region: 842-960
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000514
Family Cadherin 0.01
Further Details:      
 
Domain Number 13 Region: 2212-2476
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000284
Family Rhodopsin-like 0.031
Further Details:      
 
Domain Number 14 Region: 1701-1832
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000565
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 15 Region: 1623-1656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000076
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 1658-1701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000712
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000009191
Domain Number - Region: 1094-1118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00434
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 1157-1186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0165
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009191   Gene: ENSGALG00000005730   Transcript: ENSGALT00000009205
Sequence length 3012
Comment pep:known_by_projection chromosome:Galgal4:12:9012888:9036163:1 gene:ENSGALG00000005730 transcript:ENSGALT00000009205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSRHPRRRRRXPLFPQYNYQAEVAENQPAGTAVVAVAAQDPDGGEAGRLVYSMDALMNSR
SLELFSIDHHAGLITTTQALDRESMELHYFRVTAADHGAPRLSATTMVAITVADRNDHDP
VFEQGEYRETIRENVEEGYPILQLRATDVDSPPNANIRYRFVNERAAHAVFEIDPRSGLI
TTSGPVDREKMERYSLVVEANDQGREPGPRSATVRVYITVLDENDNTPQFSEKRYIVQVR
EDIRPHTEILRVTATDLDKDNNALVHYNIISGNSRGQFSIDSVTGEIQVVAPLDFEVERE
YALRIRAQDAGRPPLSNNTGMASIQVVDINDHAPIFVSTPFQISVLENAPLGHSVIHIQA
VDADYGENARLEYKLTGVSADTPFVVNSATGWITVSGPLDRELVEHYFFGVEARDHGSPS
LSASASVTITVMDVNDNRPEFTQKEYFIRLNEDAAVGTSVLSVTAIDRDVNSAITYQITG
GNTRNRFAISTQGGVGIITLSLPLDYKQERRYVLTVTASDRTLRDNCHVHINITDANTHR
PVFQSAHYSVSINEDRPVGSTVVVISATDDDVGENARITYYLEDNVPQFRIDPDSGAITL
QAELDYEDQVTYTLAITAKDNGIPQKADTTYVEIMVNDVNDNAPQFVSTHYQGVISEDAP
PFTSVLQISATDRDAHTNGRVQYTFQNGEDGDGDFTIEPTSGIIRTVRRLDRENVPVYEL
TAYAVDRGIPAQRTPVHIQVTIQDVNDNAPVFPAEEFEVLVKENSIVGSVVAQITAIDPD
EGPNAQIMYQIVEGNIPEIFQMDIFSGELTALIDLDYETKPEYVIVVQATSAPLVSRATV
HIKLIDQNDNSPVLKNFQILFNNYVSNKSNTFPSGVIGKVPAYDPDVSDRLFYTFERGNE
LHLLIVNQTSGELRLSRKLDNNRPLVASMLVTVTDGIHSVTAQCVLRVIIITEDMLANSI
TVRLENMWQERFLSPLLATFLEGVATVLATPKEDVFIFNIQNDTDVGGTVLNVSFSALAP
RGGHYFSSEELQEQLYMKRMALTGASMLEVLPFDDNVCLREPCQNYMKCISVLKFDSSAP
FIASPSTLFRPIHPITGLRCRCPQGFTGDYCETEINLCYSNPCLHGGTCTRKEGGYTCVC
RQHFSGENCEVDSRSGRCQPGVCRNGGTCTNGADGGFRCQCPAGGFETPFCELSTRSFPP
RSFVMFRGLRQRFHLTLSLSFSTVEPGGLLLYNGRLNERHDFLAVEIIQGQVQLKYSTGE
SSTVVSPYLPGGVSDGQWHTLQLRYYNKPKVSALGVVQGPSKDKVAILTVDECDASVALQ
FGSEIGNYSCAAEGVQTSSKKSLDLTGPLLLGGVPNLPENFPVSHRDFVGCMRDLYIDNK
RIDLASYIANNGTTAGCHAKHSFCDSSPCKNGGTCSVSWGTYSCLCPVGFGGKDCRHAMH
HAHYFQGNSVLSWDFKADMKISVPWYLGLAFRTRQMDGVLLQAHAGQYTTLLCQLSGGLL
SFMVSRGSGRSTSLVLDQLQLNDGRWHDLQLELRDVRSGRDSRYVITIMLDFGLYQDTVV
VGNELHGLKVKHLHVGGVLGSGEVQNGLRGCIQGVRLGDSVTGTVLPKPSHALRVEAGCS
VPSPCDSNPCPANSICKDEWQSYSCVCQPGYYGGECVDACHLNPCKNKSVCRRKPGSPLG
YVCECGGNFFGQYCEHRMDQQCPKGWWGNPSCGPCNCDVSKGFDPDCNKTNGQCHCKDFH
YRPKGSDTCLPCDCYPVGSSSRSCNKETGRCHCRPGVIGRQCNSCDSPFAEVTPSGCKVL
YDGCPKSLKAGVWWPQTKFGFSAVVLCPKGSLGAAVRHCDEEKGWLEPDLFNCTSPAFKE
LSMLLEGLERNETELNTIEAKKLAHRLRAVTDHMDHYFGNDVHITYRLLSRLMAFESRQH
GFGLTATQDAHFNENLLRAGSSVLAPENREHWAMLPHSEHGSASLMEQLRDYSGTLASNM
KLTYLNPVGVVTPNIMLSIDRMENHSHIRRRYPRYHSSLFRGQPAWDPHTHVVLPLSVLS
PPKAEAVPTAVPTVTGGEGNYTVESSSPRQALPEPEPALTVIILIMYRTLGGLLPARYQV
DRRSVRLPKNPVMNSPIVSVSVFSNHTFLRGPLDTPLVLEFRLLETANRSKPLCVQWNHS
SPTNPSGFWTARDCDLVYRNTTHVHCQCSQFGTFGVLMDSSHREQLEGDLETLAIVTYSL
VSLSLVALLLTFSFLTCLKGLKSNTRGIHSNISVTLFFSELLFLLGINRTENQFLCTVIA
ILLHCFFLSTFAWLFVQGLHIYRMQTEARNVNFGAMRFYYAIGWGVPAIITGLAVGLDPE
GYGNPDFCWISVHDKLVWSFAGPITVVIVMNGVMFLLVAKMSCSPGQKETKKKSVLMTLR
SSFVLLLVISATWLFGLLAVNNSVLAFHYLYTVLCSLQGLAVLVLFCVLNEEVQEAWKLA
CLGKKGQSEEAARSTQQGPNTYNNTALFEESGLIRITLGASTISSVSSVRSARTHSSQRG
YLRDNMTARQGSALDHSLLGHAGPTDIDVAMFHRDAGGDQDSDSDSDLSLDEERSLSIPS
SESEENVRLRGRFPRQFKRAAHSERLLTNPTNTAPKADVDGNDLMSYWPALGECEVHPCS
LQKWGSERKLGFDINKDAANNNQPDLALTSGDENSLTQTQRQRKDVGILKNRLQYPPALQ
GLPAVGRMTNELSWYKTSTLGHRAVPAASYGRIYSGAGSLSQPASRYSSREQLDMLMRRQ
MSREQLSRNNSENLPSRHGSRENLDLLAPRPSQRDHGNTLPRRQGSRDHLETLPCRFGSR
EQLDCGLVREVSREWLNTLPSRQGSRDRIDRLPSRDTSREQLDLLSRRQPSRDQLASSRQ
TSREHLDFLSRKSNSREPLGTVPSRQPSQENLGSLSRRQLSRENLEAIPSRHPSTEQLDI
LSSILASFNTSVLSSVQSSSTPSGPQTTANPSGMHTSTPSAMCPSTPHSSTSHSISELSP
DSERIMRNEGHS
Download sequence
Identical sequences ENSGALP00000009191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]