SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009313 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009313
Domain Number 1 Region: 10-110
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-26
Family Kringle modules 0.00068
Further Details:      
 
Domain Number 2 Region: 198-305
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.07e-24
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009313   Gene: ENSGALG00000005808   Transcript: ENSGALT00000009327
Sequence length 438
Comment pep:known_by_projection chromosome:Galgal4:15:7808411:7819197:-1 gene:ENSGALG00000005808 transcript:ENSGALT00000009327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYICSLSFHFHFFPECYTANGADYRGTQNQTSQHAGKPCLFWNETFEHPYNTLKYPNGEG
GLGEHNYCRNPDGDVSPWCYIAEHEDGIYWKYCEIPSCRMPGNLGCYKDHGEPPTLTGTS
ETSNKLTIQACISSCRSQQFKFAGMESGYACFCGNNPDYWRYGEAASTECNSVCFGDHTQ
PCGGDGRVILFDTLIGACGGNYTSATAVIYSPDFPDTYGTGKVCYWTIQVPGASQILFSF
VLFEIKDATDMVELLDGYTYHVLARFNGKNRPPHTFNISLDFVILYFFSDEINQAQGFAI
RYRAVKDNVHQNKIAANQTLSEKRNEHTNFSINAARSSKILYVITTSPSHPSSSMPEWTI
YSLTALLILSVTAILAKIFLHVAMRSHQIPPANETEDPSEVTAAGEIWSIFYRPSTSISI
FKKQLRSQQDDCNPLVGN
Download sequence
Identical sequences ENSGALP00000009313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]