SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009342 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009342
Domain Number 1 Region: 715-770
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 24-65
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000301
Family Somatomedin B domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000009342
Domain Number - Region: 60-131
Classification Level Classification E-value
Superfamily E set domains 0.00224
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009342   Gene: ENSGALG00000005824   Transcript: ENSGALT00000009356
Sequence length 770
Comment pep:known_by_projection chromosome:Galgal4:15:7829620:7845797:-1 gene:ENSGALG00000005824 transcript:ENSGALT00000009356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEKEQFLGFASVVYNKPLDRAQDSCSSQCGKLLGACSCQEICQSLGTCCPDYNEFCLH
ISPYSGSLMGGKDFLIENTAFNTSVLMCRFKQQVITSGYVDKDGKAHCLSPLLYETGFIP
FEVSTDGGLTFPYSGTWLSVHHSKVSGGEKCTLVNETKWQYYGTPGTGGNLTLTWTHQAL
AASHINIEVWGYQETGDSYSENWLAEWKYLYTLAREAPNTGTFSFIPVPAEANYNTWDFG
ILRITPSTYSDGQSNTPSIWSPAHALAWHLSEDFRNKPAAWATAKCIEWDREEEKLPNFM
EEIIDCPCTLAQARADTGRFHTDYGCDIEKGSVCTYHPGAVHCVRAIQASPQYGAGQQCC
YDSTGTQILTQDSTGGSTPDRGHDWGAPPFLKPPRIPAFSHWLYDVISFYYCCLWSDNCH
FYMKNRPSSDCRTYRPPRAASAFGDPHFLTFDGLNFTFKGQGEYTLVESDLTSLRVQGRT
QQARFPNGTQAQVTGLSAVAMQENNSDVIEVRYSEDLNLEVLLNQRVVNFSEQSWMDLEG
LFLHSTDDQKVTVMFSSGSGMEIRGSGGFLTLTVLLPEKFMNHTQGLFGVMNGNTEDEFT
FKNKTTMSVHASPQQLFEFGASWAVENGTSLFTYDTETLLNDYFYGEKHNASFLPVFHPQ
EDPADPLVEEMVSLCDSDPFCRFDVLTTRSLQAGNFTRLSHQNHKQLVESLEPVISCGWL
GPPANGRKDGTNYLLGSAIHFTCNQGYELAGTKERICQATGAWSGDSPSC
Download sequence
Identical sequences ENSGALP00000009342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]