SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009466 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009466
Domain Number 1 Region: 773-881
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.66e-24
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 313-433
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-17
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 34-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000368
Family EGF-type module 0.021
Further Details:      
 
Domain Number 5 Region: 206-247
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000617
Family EGF-type module 0.025
Further Details:      
 
Domain Number 6 Region: 643-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000133
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 7 Region: 166-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000017
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009466   Gene: ENSGALG00000005892   Transcript: ENSGALT00000009480
Sequence length 959
Comment pep:known_by_projection chromosome:Galgal4:5:8927057:8961764:1 gene:ENSGALG00000005892 transcript:ENSGALT00000009480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGGRPSAAGARALPLLLLLLPAPGPAAPPPPDVDECALGLDDCHPDAICQNTPKLYKC
MCKVGFTGEGKKCEDIDECDNDFNGGCVHECFNIPGNYRCTCYDGFMLAHDGHNCLDTDE
CMFNNGGCQHVCVNTVGSYECRCKEGFFLSDNQHTCIHRSEEGMSCMNKDHGCAHICRET
PKGGVACECRPGFELSKNQRSCILTCNHGNGGCQHTCDDADNGPICGCHPKYIMHTDGKT
CLEREEAAVEIPEGNTTAGADVDKRVKRRLLMETCAVNNGGCDRTCKDTSTGVHCSCPVG
FTLQFDGKTCKDIDECQSNNGGCDHFCKNTVGSFDCSCRKGFKLLTDEKSCQDIDECSFE
RTCDHTCINHPGTFECTCNKGYALYGFTHCGDINECSINNGGCQQLCVNTPGDYECLCHS
NYKLHWNKKDCVEIKESFPDNMSPKVLLHCMKSGRSDRCFLSCSSDVRVVSGTQDAYTLA
CGSSSQLKKKQQNTNASTWLDISTIKISVTFKLNEGKCSLKKTEMFQEGLEQTIPERHNS
VMESFHYVNLTCSSGKKVHGALSRLPATREIFITADFELETNQKEVTDTCDVRCARKKTE
KRFRKTIRTLRKTVSRDQFRVRVSGMDHEVARKSLKLSEPQQSCGVGQMHVGSRCDQCSP
GEYSSDGFKPCLPCPIGTYQPEAGRVSCFPCGGGLTTRHSSTSLFQDCETKVQCSPGHFY
NTTTHRCIRCMVGTYQPEFGQNYCISCPGNTTTDYDGSTNITQCKNRQCGGELGDYTGYI
ESPNYPGDYPANTECTWNINPPPKRRILIVVPEIFLPIEDECGDYLVMRKSSSSNSVTTY
ETCQTYERPIAFTSRSKKLWIQFKSNEGNSAKGFQVPYVTYDEDYQELIEDIVRDGRLYA
SENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK
Download sequence
Identical sequences A0A1D5PS52
ENSGALP00000009466 XP_015141960.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]