SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009639 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009639
Domain Number 1 Region: 240-442
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.73e-48
Family Reprolysin-like 0.0022
Further Details:      
 
Domain Number 2 Region: 534-589
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 4.45e-16
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 3 Region: 890-948
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000628
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 4 Region: 942-1001
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 
Domain Number 5 Region: 827-886
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009639   Gene: ENSGALG00000006000   Transcript: ENSGALT00000009653
Sequence length 1187
Comment pep:known_by_projection chromosome:Galgal4:13:12982380:13153634:1 gene:ENSGALG00000006000 transcript:ENSGALT00000009653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPAGFACVLLCCALCLPAAAPRRPGHRDPILRNIEEYSLVIPTSTDSEGRFLSHLVSG
PPKARFRRAADDLQHKAANEQIFYNVTVFGREFHFRLRPNSRLVAPGATVEWQEDSDETH
IEPLYGNCLYVGDITDLPNASVAISNCDGLAGMIRTDKDEFFIEPLEKGTREEEEEGGRT
HVVYRRAAAKKQLPIEDADTLYKAPNLTNLDGLDSALSLIEDGVRRSRQRHRRHATDDDY
NIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKS
MSLIEIGNPSQSLENVCRWAYLQQKPDTGHAEYHDHAIFLTRQDFGPSGMQGYAPVTGMC
HPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRF
HWSRCSQQELNRYLHSYDCLRDDPFEHDWPSLPQLPGIHYSMNEQCRFDFGLGYMMCTAF
RTFDPCKQLWCSHPENPYFCKTKKGPPLDGTMCAPGKHCFKGHCIWLTPDILKQDGHWGA
WSKFGSCSRTCGTGVKYRTRQCDNPHPANGGRTCVGPSYEFQLCNTQDCPKDFEDFREEQ
CRQWDPYFEYQNTKHHWLPYEHVDAKERCHLYCESKETGDVVYMKRMVHDGTRCSYKDAY
SICVRGECLKVGCDRVIGSTKQEDKCGVCGGDNSHCKVVKGTFSRVPKKQGHIKMFEIPV
GARHLLIQESDATSHHLAIKNRETGRFILSEDNYVPDSKVFIDMGVEWEYRNDDNRETVQ
TMGPLRNGIVILVIPHGGAKISLTYKYMIHEDSLNVDNNNVLEEDSVSYEWALKKWSQCS
RPCGGGFQFTKYGCRRKTDHKMVHRSYCELIQKPKPIRRVCNLQECSQPIWVTGEWEPCS
KSCGKTGYQVRSVRCIQPLHDNTNRSVHTKYCNNDRPEGRRPCNRELCPAQWRIGPWSQC
SVSCGNGTQDRPVLCRTSDNAIGLCKEAKPENVKICRLPPCPRNISDPSKKTYMIQWLSR
PDPDYPIQKISSKDHCQGDKSMFCRMEVLSRYCSIPGYNKLCCKSCNMYNNVTEEGNATD
SNANKNNVIEEELLTTPSPLTGVPTTQPATTSPPPVSKPPMPPSNATDEHPEINAVDVPY
KIDGLDNEVSQHNIITQRRIPYERTRNQRIQELIAEKRKKETLRRIN
Download sequence
Identical sequences ENSGALP00000009639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]