SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009711 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009711
Domain Number 1 Region: 963-1142
Classification Level Classification E-value
Superfamily Fibronectin type III 2.02e-21
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 2 Region: 790-832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000105
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 816-941
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000116
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 4 Region: 385-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000174
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 5 Region: 309-351
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000298
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 6 Region: 733-802
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000688
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1263-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000661
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 658-693
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000228
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 9 Region: 580-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000437
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 10 Region: 468-506
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000679
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 620-655
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000804
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 12 Region: 696-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000164
Family EGF-type module 0.03
Further Details:      
 
Domain Number 13 Region: 349-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000514
Family EGF-type module 0.018
Further Details:      
 
Domain Number 14 Region: 269-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000129
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 15 Region: 423-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000068
Family EGF-type module 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000009711
Domain Number - Region: 510-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000151
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 544-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00839
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009711   Gene: ENSGALG00000006039   Transcript: ENSGALT00000009725
Sequence length 1366
Comment pep:known_by_projection chromosome:Galgal4:9:4388903:4408558:1 gene:ENSGALG00000006039 transcript:ENSGALT00000009725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPAGWVALAALLGEWLRAGGVVPLADFYPFGPAQGDAATLKQDDGGSELRPLSVRFPF
FGAGHTGLYVNNNGIISFLKEVSQFTPVAFPISKDRRVVAAFWADVDNRRAGDVYYRESQ
DRAILERATRDIARYFPEFPDFSAQWVFIATWYRVTFFGGSSFSPVNTFQIVLITDGKLS
FTIFNYESITWTTGMHASSGGDFAGLGGIAAQAGFNAGDGKRYFNIPGSRTDDIADVEMT
TNVGIPGRWVFRIDDAQVQVGGCSNTTSVCLTLRPCLNGGKCIEDCITGNPSYTCSCLAG
FTGKRCHVDVDECLSHPCQNGATCINSVNSFSCQCLPGFRGASCEIEESPCETKVCQNGG
TCQVANGTAVCTCQPGYAGGDCETEVNECESSPCLNGGHCVDLVDNYTCVCLEPFVGQRC
ETDPSSCEDRSCRNRQTCNYIRPGRYICTCSPGYYGNNCQYGGPRVPSACLSNPCQNGGS
CLELEQGYACDCPEGYAGQDCRDKLTEGCECRNGGSCLEGNVTICQCLPGYFGLLCEFEV
TTTPCNVNTQCPDGGYCMEYGGSYLCVCHTDYGTNHTVPSPCDSEPCLNGGSCETQDDSY
TCECPSGFLGKHCERARPRLCSTAPCRNGGTCKEADGEYHCACPYRFTGRHCEIGKPDPC
ASGPCQNGGTCFHYIGKYKCDCAPGYAGRHCEIVPSPCFLSPCENGATCEELGGDFVCTC
PMGYTGKRCGTEIDCGMPSAVKHAQASFNSTTVGSLAKYHCELGYVLSQHNSPRVCRSQG
VWSDPPECDEIDECRSQPCLNGGQCKDRIAEFLCVCEPGYTGLHCELEVDECQSEPCKNG
GTCRDLLGSFACSCPAGFMGTQCEEEVDACESDPCQNGGECEGDGGSYLCVCPEGFFGYH
CETASDPCFSSPCGSRGYCLPSNGTHSCTCKVSYTGKSCEKVKRNVNNKNDISRPVMLTT
RTRPRPVEGFEITNVTASTITVQWALHRLKHSTVSRVRVSIRQPGDLEDRTVELNSSVAK
YTFLDLQPGERYIVHVTTLSGMGTEDHPSESLATAPFHVWTRPLPPRNLTASRVTPTSVS
VTWEQPPTGAVEGYIINVTTAQSVKSRYVPNGKLASYTVRDLLPAQRYRLSVTAVQNTEQ
GQVHSEPIHLYVTTLQKDGAPERRWSQAGHPRVLRNRLPPAFLPELRLLADHDTAEEPSP
APRFTELVDGRRRISARFGTLPSKSITVKTQPEAPVRLENSEEPSRSSLALQLREAWSKS
IRQNCSTNPCKNGGTCVSESESYHCDCIPGFKGRHCELACKKVPHSCTRLYSETKSFPVW
EGGTCHYLYRRVYKVHQDVCYKESCESTGSKKTSRKRSDSHTLKKP
Download sequence
Identical sequences ENSGALP00000009711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]