SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009799 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009799
Domain Number 1 Region: 5-264
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.5e-85
Family Eukaryotic proteases 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009799   Gene: ENSGALG00000006081   Transcript: ENSGALT00000009813
Sequence length 291
Comment pep:known_by_projection chromosome:Galgal4:LGE22C19W28_E50C23:132266:135861:1 gene:ENSGALG00000006081 transcript:ENSGALT00000009813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLEVLVECGRRPLMDSAAGSRIVGGHEAPLGAWPWAVSLQVHLVGVEFAHVCGGALVSE
NSVLTAGHCTTGRMDPYYWRAVLGTDNLWKHGKHAAKRSITHIFVHPEFNRETFENDIAL
FKLHSAVHYSNYIQPICLPPAHPQLYTHNKTKCFISGWGRIAEKGRTSSVLQEAEVEIIP
SDVCNGSDAYGGLINANMICAGSPLGGVDSCQGDSGGPLACHHPTANKYYMMGVTSFGLG
CGHPNFPGIYVRLAPYRRWIKSQLLLSSTATAPASTALTLTAVGMVLLYAS
Download sequence
Identical sequences A0A1D5NTM1
ENSGALP00000009799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]