SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000009840 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000009840
Domain Number 1 Region: 1314-1387
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 926-999
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000127
Family I set domains 0.047
Further Details:      
 
Domain Number 3 Region: 1213-1287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000434
Family I set domains 0.03
Further Details:      
 
Domain Number 4 Region: 421-481
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000549
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 708-761
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 6 Region: 763-821
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 1683-1738
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 8 Region: 816-882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000183
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 573-627
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000196
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 10 Region: 476-536
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000497
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 11 Region: 1503-1560
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000968
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 12 Region: 77-125
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 13 Region: 1555-1621
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000034
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 14 Region: 343-403
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000085
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 15 Region: 1419-1498
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000116
Family I set domains 0.095
Further Details:      
 
Domain Number 16 Region: 650-705
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000157
Family TSP-1 type 1 repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000009840   Gene: ENSGALG00000006104   Transcript: ENSGALT00000009854
Sequence length 1775
Comment pep:known_by_projection chromosome:Galgal4:10:10980738:11157843:1 gene:ENSGALG00000006104 transcript:ENSGALT00000009854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPNGAGLFWEVIWLAIAVYAHLQTRAEQSQGAYFLPEFALSPQGSFLEDTTGEQFLTY
RYDDQTSRITRSDEDKDGSWDAWGAWSDCSRTCGGGASYSLRRCLNGRNCEGRNIRYKTC
SSNDCPSDVGDFRAQQCSAYNDVKYQGHFYEWIPVYNDPTAPCALKCQALGKNLIVELAP
KVLDGTRCNTESLDMCISGICQAVGCDRQLGSNAKEDNCGICAGDGSTCRLVRGQAKAHV
SPEKREETVIAVPHGSRSVRITLKGPAHLVIESKTLQGDKGEHSFEEPGTFVIENTTVEF
QKTTDREIIKIQGPLGADFIIKTRYSGSKDSVVQFFFYQPISHQWRQTEFFPCTVTCGGG
YQLNSAECVDIRLKRVVPDHYCHYYPENKKPKPKLKECNMDPCPSSDGFKEIMPYDHFQP
LPRWEHNPWTACSVSCGGGIQRRSFVCVEETIHGEILQVEEWKCMYAPKPKVIQTCNLFD
CPKWVAMEWSQCTVTCGRGLRYRVVLCIDHRGQHVGGCNPQLKLHIKEECIVPIPCYKPR
EKSPVEAKSPWFKQAHEMEETRAVSEEPTFIPEPWSPCSATCGSGIQVRDVKCRILLSFT
QTEVDLPEEECEDVKPPTEQVCHEAPCDSNPVPYTPEFSRAEDGSVIYDWEYIGFTPCSA
TCLGGTQEAIAMCLHVETKQAVNETLCDNSKRPPPMTHACNMKLCPPRWQTGPWRRCSAT
CGVGIQTRDVYCQQPGGSTVAVEDCKDKKPHSLQACNQIDCPPVWHVEEWQQCSRTCGGG
IQTRKVYCKQLLTDGSFLKHSDDTCREPKLPTTKSCAKVDCPPQLVVGEWSKCSVSCGVG
IQRRKIACQNRTAKGQYVAVNESMCSGLSPSLLVRSCQMNACNKIKPKLPEKYSTHGPRI
IGIHRVYIQTRQEKRINFTIGSRAYLLPKTSVVIKCPVRRFQKSLIRWEKDEQHLQNSKR
LGITKSGSLKIHSLEAADIGVYRCIAGSAHETFVLKLIGNDNRLIEPPNLRKHASEITNA
DHNEANSFGAKWHKMSKMWQMWSKKNELYLGERQVNDQPFLRNLEAFRSNSAGVFSSREF
KNKRLEAAVLQGAYSMDTAQFEELIRNMSQLIETGEVSDDLASQVIYQLIAELSRPPQST
TEKWKGAQDEKLASKFTGKSPNESDRFSTKTVDKLMSDQKVPVIMRQKEIPGVSFNKTVT
VQIGNTVFLTRNTQSVNLLCETAGISEVKYTWTKDGETLKSSEKVILDTIGKVQIRSPTE
KELGTYGCLVVNDFGFDMETSLLLRAEVPVILFSMLNVTNVEASNLSAVVGGTIVAKIGA
NITIECPVKGVPQPNVTWFMKKGILQINSFLLSNGSLFLRNVSYEDAGTYTCRATNALGK
AEAASVLHLREQRLTENNTLLLKGSRKKRVIMASGIGTNVSVVPGDPLRVGCPVLPSSRN
TVHWLFRGSPIEEVKALEYRVLAGGRILEVNTNSGQFAGRFQCWTSANAKPVSVWVNVKK
EDYKWEYAEWSTCSANCGNSGTRSRKLQCMNSEEQKVNESFCRDLQKPAISYQSCNRDDC
PARWVPGRWSECSATCGSGFRYRQISCQQVKANGSVETVLAGACMHQDRPVGRKPCTGYS
CTAGTTQTKEQCSGSCVGRPVASQHHHFLCRLHNGSLMPNSSCEERKRSAVRRNCSSEVC
DVYWRTGPWRPCSVQCGSGFQSRRVHCVHRKNNKLVADQYCGWKKRPVSWQHCNATACGK
DECKDTTHYCTFAKQLRLCLIDVYKQRCCLSCQEM
Download sequence
Identical sequences ENSGALP00000009840 XP_004943881.1.86415 XP_004943882.1.86415 XP_004943883.1.86415 XP_004943887.1.86415 XP_413844.3.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]