SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010101 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010101
Domain Number 1 Region: 65-184
Classification Level Classification E-value
Superfamily EF-hand 1.94e-34
Family Osteonectin 0.023
Further Details:      
 
Domain Number 2 Region: 153-249
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.66e-28
Family Thyroglobulin type-1 domain 0.00082
Further Details:      
 
Domain Number 3 Region: 3-49
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000416
Family Ovomucoid domain III-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010101   Gene: ENSGALG00000006258   Transcript: ENSGALT00000010115
Sequence length 353
Comment pep:known_by_projection chromosome:Galgal4:13:13906202:14163956:-1 gene:ENSGALG00000006258 transcript:ENSGALT00000010115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKCKPCPTVHASPVCGSDGHTYTTKCKLEFHACTSGKTITARCEGPCPCLPGPESPKHK
TEKTACTDKELRSLASRLKDWFGALHEDANRVIKPTSSETAQGRFDTSILPICKDSLGWM
FNKLDMNYDLLLDPSEISAIYLDKYEPCVKPLFNSCDSFKDGKLSNNEWCYCFQKPGGLP
CQNEMNRIQKLSRGKSLLGAFIPRCNEEGYYKATQCHGSTGQCWCVDKYGNEIAGSRKQG
TVSCEEEQETSGDFGSGGSVVLLDDLEEEPEATKKDKEGKVKIHVRAANEDDEDEDDDKD
DEIGYIWTSEWGEPRRALCIHTTQTACWWGRCCWLRFNCRKTLRNKFTFSSPL
Download sequence
Identical sequences ENSGALP00000010101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]