SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010226 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010226
Domain Number 1 Region: 118-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000001
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 2 Region: 23-82
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000378
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010226   Gene: ENSGALG00000006335   Transcript: ENSGALT00000010240
Sequence length 210
Comment pep:known chromosome:Galgal4:1:3377295:3393600:-1 gene:ENSGALG00000006335 transcript:ENSGALT00000010240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELKRLLMWLLLGSIMGTGADKCPRLSTTEFADVAAETYPLKTKLRYECDSGYRRRSGNT
LTIRCQNVSGTASWVHDELVCIDEKFFSRNHTAKLNPTQQPARQTQSPAPPKQANNSSFC
GMPQTVPHASLSVHQIYSVGQVLHFKCPTGYNKQLPTTGTITCKNVDGRIKWTPVDRPCT
NDSGPINKQLSHLMEAVIFFILLLHSAVFL
Download sequence
Identical sequences ENSGALP00000010226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]