SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010255 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010255
Domain Number 1 Region: 70-339
Classification Level Classification E-value
Superfamily EndoU-like 1.44e-94
Family Eukaryotic EndoU ribonuclease 0.0000064
Further Details:      
 
Domain Number 2 Region: 21-64
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000122
Family Somatomedin B domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010255   Gene: ENSGALG00000006353   Transcript: ENSGALT00000010269
Sequence length 343
Comment pep:known_by_projection chromosome:Galgal4:LGE22C19W28_E50C23:443292:449786:1 gene:ENSGALG00000006353 transcript:ENSGALT00000010269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFILFLGVGTALGSLYTDPDSCRGRCEEPYSHEDECHCDVGCRSRNSCCWDYPEHCGA
EHFSSSHNAISDEELLHVSEQLYGADHNKAQPNDITINPQHRAAPDQTGLQEDRSPEPLY
AYVNEKLFSKPTYSSFIRLLDNYQRATGREEEVTAEELREQDVFLREVMETELMKKLFAF
LHTKNRYGSEEEFLQDLKEMWFGLYSRGDGEKDSSGFEHVFSGEIKKGKVSGFHNWIRFY
LLEKQGLVNYFSHNFDGPWDTYPDVLGLQFSWDGFYKEVGSAFIGCSPEFEFGIYTLCFI
ARPGRACHLSLGGHGVSIQTYTWTKSTYGHGKKYIAAAYVISP
Download sequence
Identical sequences A0A1D5PJT7
ENSGALP00000010255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]