SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010380 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010380
Domain Number 1 Region: 57-168
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000000262
Family Mannose 6-phosphate receptor domain 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000010380
Domain Number - Region: 175-270
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.00746
Family Type II DNA topoisomerase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010380   Gene: ENSGALG00000006441   Transcript: ENSGALT00000010394
Sequence length 311
Comment pep:known chromosome:Galgal4:14:7411297:7422298:1 gene:ENSGALG00000006441 transcript:ENSGALT00000010394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARLLLAVFVGAALGVLASAGKMKIVEEPNTFGLNNPFLPQTNRLQPKMLPSAISGPV
HLFRLAGKCFSFVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIDNNTFVGMW
MREGDSCETKSRQTKVHLVCGKSNKLAYVSEPSTCVYSLTFETPLVCHPHSLLVYPTLTE
ALQRKWDEAEQSLYDQLITEQGYKKILKEIFEEAGLLKATEEKEAEKQNMKTSLQFETVD
KCNKEYKKLSEEIKVLKDLLNQHNIAYQRSSAENTSVEHVNHKWATAETTRRPASRSPAL
RGEGPGLRGGG
Download sequence
Identical sequences ENSGALP00000010380 ENSGALP00000010380 9031.ENSGALP00000010380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]