SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010650 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010650
Domain Number 1 Region: 836-1033
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.00000000000061
Family Mannose 6-phosphate receptor domain 0.0061
Further Details:      
 
Domain Number 2 Region: 259-291,447-499,547-588
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000373
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 3 Region: 757-840
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000707
Family Growth factor receptor domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010650   Gene: ENSGALG00000006606   Transcript: ENSGALT00000010664
Sequence length 1186
Comment pep:known_by_projection chromosome:Galgal4:1:7422961:7518502:1 gene:ENSGALG00000006606 transcript:ENSGALT00000010664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRLRSSMINYVSHLDIHHVSHLVGSQTKRGKPAMLAQKERGDGCQLSLCILQPCARTGS
RAGRQGPQPGIPNQEFHPSEMAKVQAGGALRFAPGLVEPRQHAPALPACLPAFLLLLLFL
LAPPPGCGGAGCRHGAGGAAALRASSVRLPAGLCPAAEAAAGSGAGEPRAAAAERGKGCA
AAPLRERRMKRRIWCPGTAWVCCWLLGWQAAALQLPPCEETDYHFEYTECDSSGSRWRVA
VPNPSAECSGLPDPVKGKECTFSCASGEYLEMKNQVCSKCAEGTYSLGSGIKFDEWDELP
AGFSNVATFMDTAVGSVENKANSCNNSSWTPRGNYIESNRDDCTVSLIYAVHLKKSGSVF
FEYQYIDNNIFFEFFIQNDQCKEMESTADKWVKLTDNGEWGSHSVTLKSGSNILYWRTTG
ILMGSKVVKPVLVKNITIEGVAYTSECFPCKPGTYSDKPGSSGCQECPRNTYSEKGAKEC
TKCKEEIYYAEEGSSACIERPPCTSKDFFQIHTPCDKEGKTQIMYKWIEPKICREDLPDA
LTLPPSGERKECPPCNPGFYSNASSSCTPCPQGMFSDGTQECKACPAGTEPALGFEYKWW
NILPSNMKTSCFNVGNSKCDGMNGWEVAGDHIQSGAGGSDNDYLILNLHIPGFKPPTSVT
GATGSELGRITFVFETICSADCVLYFMADINRKNTNVVESWERSKEKQSYTHIISKNASF
TFTWAFQRINEGQDSRQFINDVAKIYSITVTNAVDGVASSCRACALGSEQSGSSCVPCPV
GHYIEKETSQCKECPANTFLSIHQVYGKEACIPCGPGSKSTKDHSACFSDCLVSYIKDNQ
TLSYDFSNLSQVGSLMSGPSFTSRGTKFFHFFNISLCGNEGKKMAICTDNITDVTLKDMV
AESEDFSNFVGAFVCQSTIIPSDSKGFRTALALQSNSLADRFLGATVETMLENISVKTDM
FPPSPSKIPDVHFFYKSSTATTSCEDGRATVVIMRCNPNKPDQGELSVPSSCPAGTCDGC
TFYFVWESAEACPLCTEQDYHEIEGACKKGFQETLYVWNEPKHCIKGVPLPEKRTSTCET
VDFWLKVGAGVGAFAAVLLIALTCYFWKKNQKLEYKYSKLVMTANSKECELPAADSCAIM
EGEDNEEEIVYSNKQSLLGKLKSLATKEKEDHFESVQLKSSRSQNI
Download sequence
Identical sequences ENSGALP00000010650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]