SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010852 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010852
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000563
Family ATI-like 0.049
Further Details:      
 
Domain Number 2 Region: 763-825
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000144
Family ATI-like 0.048
Further Details:      
 
Domain Number 3 Region: 664-724
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000157
Family BSTI 0.082
Further Details:      
 
Domain Number 4 Region: 1699-1763
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000628
Family ATI-like 0.047
Further Details:      
 
Domain Number 5 Region: 817-865
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000126
Family Fibronectin type I module 0.053
Further Details:      
 
Domain Number 6 Region: 1135-1190
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000209
Family ATI-like 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000010852
Domain Number - Region: 353-400
Classification Level Classification E-value
Superfamily FnI-like domain 0.000105
Family Fibronectin type I module 0.048
Further Details:      
 
Domain Number - Region: 1858-1941
Classification Level Classification E-value
Superfamily FnI-like domain 0.000167
Family VWC domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010852   Gene: ENSGALG00000006717   Transcript: ENSGALT00000010866
Sequence length 2108
Comment pep:known chromosome:Galgal4:5:14243984:14284324:-1 gene:ENSGALG00000006717 transcript:ENSGALT00000010866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIKKERSFWIFCLIWSFCKGKEPVQIVQVSTVGRSECTTWGNFHFHTFDHVKFTFPGTC
TYVFASHCNDSYQDFNIKIRRSDKNSHLIYFTVTTDGVILEVKETGITVNGNQIPLPFSL
KSILIEDTCAYFQVTSKLGLTLKWNWADTLLLDLEETYKEKICGLCGNYDGNKKNDLILD
GYKMHPRQFGNFHKVEDPSEKCPDVRPDDHTGRHPTEDDNRCSKYKKMCKKLLSRFGNCP
KVVAFDDYVATCTEDMCNCVVNSSHSDLVSSCICSTLNQYSRDCVLSKGDPGEWRTKELC
YQECPSNMEYMECGNSCADTCADPERSKICKAPCTDGCFCPPGTILDDLGGKKCVPRDSC
PCMFQGKVYSSGGTYSTPCQNCTCKGGHWSCTSLPCSGSCSIDGGFHITTFDNKKFNFHG
NCHYVLAKNTDDTFVVIGEIIQCGTSKTMTCLKNVLVTLGRTTIKICSCGSIYMNNFIVK
LPVSKDGITIFRPSTFFIKILSSTGVQIRVQMKPVMQLSITVDHSYQNRTSGLCGNFNNI
QTDDFRTATGAVEDSAAAFGNSWKTRASCFDVEDSFEDPCSNSVDKEKFAQHWCALLSNI
SSTFAACHSVVDPSVYIKRCMYDTCNAEKSEVALCSVLSTYSRDCAAAGMTLKGWRQGIC
DPSEECPETMVYNYSVKYCNQSCRSLDEPDPLCKVQIAPMEGCGCPEGTYLNDEEECVTP
DDCPCYYKGKIVQPGNSFQEDKLLCKCIQGRLDCIGETVLVKDCPAPMYYFNCSSAGPGA
IGSECQKSCKTQDMHCYVTECVSGCMCPDGLVLDGSGGCIPKDQCPCVHGGHFYKPGETI
RVDCNTCTCNKRQWNCTDSPCKGTCTVYGNGHYMSFDGEKFDFLGDCDYILAQDFCPNNM
DAGTFRIVIQNNACGKSLSICSLKITLIFESSEIRLLEGRIQEIATDPGAEKNYKVDLRG
GYIVIETTQGMSFMWDQKTTVVVHVTPSFQGKVCGLCGDFDGRSRNDFTTRGQSVEMSIQ
EFGNSWKITSTCSNINMTDLCADQPFKSALGQKHCSIIKSSVFEACHSKVNPIPYYESCV
SDFCGCDSVGDCECFCTSVAAYARSCSTAGVCINWRTPAICPVFCDYYNPPDKHEWFYKP
CGAPCLKTCRNPQGKCGNILYSLEGCYPECSPDKPYFDEERRECVSLPDCTSCNPEEKLC
TEDSKDCLCCYNGKTYPLNETIYSQTEGTKCGNAFCGPNGMIIETFIPCSTLSVPAQEQL
MQPVTSAPLLSTEATPCFCTDNGQLIQMGENVSLPMNISGHCAYSICNASCQIELIWAEC
KVVQTEALETCEPNSEACPPTAAPNATSLVPATALAPMSDCLGLIPPRKFNESWDFGNCQ
IATCLGEENNIKLSSITCPPQQLKLCVNGFPFMKHHDETGCCEVFECQCICSGWGNEHYV
TFDGTYYHFKENCTYVLVELIQPSSEKFWIHIDNYYCGAADGAICSMSLLIFHSNSLVIL
TQAKEHGKGTNLVLFNDKKVVPDISKNGIRITSSGLYIIVEIPELEVYVSYSRLAFYIKL
PFGKYYNNTMGLCGTCTNQKSDDARKRNGEVTDSFKEMALDWKAPVSTNRYCNPGISEPV
KIENYQHCEPSELCKIIWNLTECHRVVPPQPYYEACVASRCSQQHPSTECQSMQTYAALC
GLHGICVDWRGQTNGQCEATCARDQVYKPCGEAKRNTCFSREVIVDTLLSRNNTPVFVEG
CYCPDGNILLNEHDGICVSVCGCTAQDGSVKKPREAWEHDCQYCTCDEETLNISCFPRPC
AKSPPINCTKEGFVRKIKPRLDDPCCTETVCECDIKTCIINKTACDLGFQPVVAISEDGC
CPIFSCIPKGVCVSEGVEFKPGAVVPKSSCEDCVCTDEQDAVTGTNRIQCVPVKCQTTCQ
QGFRYVEKEGQCCSQCQQVACVANFPFGSVTIEVGKSYKAPYDNCTQYTCTESGGQFSLT
STVKVCLPFEESNCVPGTVDVTSDGCCKTCIDLPHKCKRSMKEQYIVHKHCKSAAPVPVP
FCEGTCSTYSVYSFENNEMEHKCICCHEKKSHVEKVELVCSEHKTLKFSYVHVDECGCVE
TKCPMRRT
Download sequence
Identical sequences F1NZY2
ENSGALP00000010852 XP_003641415.1.86415 XP_015142012.1.86415 XP_015142013.1.86415 ENSGALP00000010852 9031.ENSGALP00000010852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]