SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010853 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010853
Domain Number 1 Region: 266-324
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000294
Family BSTI 0.073
Further Details:      
 
Domain Number 2 Region: 632-692
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000128
Family BSTI 0.075
Further Details:      
 
Domain Number 3 Region: 730-792
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000736
Family ATI-like 0.02
Further Details:      
 
Domain Number 4 Region: 324-369
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000785
Family Fibronectin type I module 0.059
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000010853
Domain Number - Region: 1104-1159
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000589
Family ATI-like 0.066
Further Details:      
 
Domain Number - Region: 792-832
Classification Level Classification E-value
Superfamily FnI-like domain 0.00607
Family Fibronectin type I module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010853   Gene: ENSGALG00000006740   Transcript: ENSGALT00000010867
Sequence length 4251
Comment pep:novel chromosome:Galgal4:5:14079795:14176709:-1 gene:ENSGALG00000006740 transcript:ENSGALT00000010867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPSHNGRVCSTWGNFHFKNFDGDIFYFPGVCNYIFASNCKSPYEDFNIQIRRTMVENATV
ITHVIMRLEGAVVELTRTSVLVNGKQIQMPYSHMGVLIERSNSYIKVSAKLGLTFLWNEE
DALLVELDKKYANQTCGLCGDFNGIPTNNEFISQNAKLTAVQFGNRQKIDGPTEQCDDPI
PSAVLMNCSSEFASICKTVLTSEAFTSCNALVDVQDYIDTCIQDLCHCDTSMADFCMCNT
FAEYSRQCAHAGGQPLNWRTSELCPKSCPFNMQHQECGSPCSDTCSNPERSALCEDHCTD
GCTCPPGMVFDDINGAGCIPRKECHCTYEGETYAPGTSFSSKCRSCTCAGGEWTCVTQSC
PATCSIEGGSHITTYDEKYYSFYGDCSYVLTKLCDSNDFTVLGDIHKCGLTDTETCLKGV
AISLSGGQTNIVIQPSGSVFVNMIYTQLPFSAANVTIFRPSSFFIILQTTFGLQLQIQIV
PLMQLFINLDPSQKGQTCGLCGNFNDIQTDDFKTTSGVIEGTSAAFGNTWKTRADCPDAK
ITFENPCTLSIENDKYAQHWCGLLSDTTGPFAECHSTVNPEVYQKNCMFDTCNCENTEDC
MCAALSSYVRACAAKGILLNGWRNKVCTKYTNTCPKSLEYTYNVDSCQPTCRSLSEPDVT
CNIKFVPVDGCTCVNGTYMDESGKCVPAASCPCYYKGMPLSTGEVIHDNGVVCTCSYGKL
SCIGEKPPPVCAPPMVYVDCGNATAGVTGAECQKSCQTLDMECYKTHCVSGCICPPNYVS
DGKGGCIAAEECPCVHNGDSYRPGESIRVGCNNCTCRNRKWHCSEEPCLETCSVYGDGHY
TTFDGKRFDFEGDCEYVLIQNYCGRKGLNQGTFRVITENIPCGTTGTTCSKSIKVFLGNY
ELVLSDGHSDVIQRSPGGEMPFQIRSMGIYMVVDTTVGLILMWDKKTSIFIKLSPSFQGH
VCGLCGNYDGNGNNDFTTRSQSVVGNVLEFANSWKVSSTCPNANQTKDPCTANPYRKSWA
QKQCSIITSEVFAKCHSQVEPNEYYQACVDDACACDTGGDCECFCTAVAAYAQACNELDI
CISWRTPSICPLFCDYYNPQGECEWHYKPCGAPCMKTCNNPSGKCLHELRGLEGCYPHCP
KNKPYFDEETMACVSNCGCYENGKHYKPGMQMPSKQNCQTCECTNHGKICKYDEHECVCI
YEGRTYNYTDMIYNTTDGIGGCIVATCGPNGTLQRVVYDCPISTSPTTPFHFSTTPPATA
STVTSSPTTSVCVHEVCQWSEWYDGSPLIPGFDGGDFETFSDLRAKGYEVCRDPKAVQCR
AEKFPNIPLKDLGQRVECNTQSGLICYNKDQISTMCYNYEIRILCCVFVPCSSTSSITTP
YETSTLITHTPVPEKTTTATSTIITTSSTTTETGSTTITSTSSETASTSPEAIRTTPCQP
KCKWSKWYDVHFPTLHNKGDYETYQDIRSAGKAICRNPEKIQCRAEKYPHKSIEEIGQVV
HCNVTYGLICRNEDQKGELHICLNYQVKVFCCDDYSHCQTRVTPTVPEEITTTITQSPAT
TTSETSTFTTKLTSPVTISPTTSALCVKECCKNVTVPCQTTKTPYSTTKKPTTSTISTTQ
TTPYTETSTMTYTPKIQTKHKTTTIETIPPRTENIHSETTSTPKQSIQTETKTTTILTVT
TSTSTATPTTTIETSTSTSTLTPTPTLISTTSSPSTTTHVTACELELCSWTDWFDVDFPS
SGTSQGDFETYQHIRAAGKEVCQQPKQIECQAEDYPEISIEQVGQVVQCDVHYGLVCKNQ
DQHGSFKMCLNYRIRVLCCRPNPDCVQTITPTTSPTTTISTGTSSSTTPTLSVTTSTSTA
TPTTTIETSTSTSTLTPTPTLISTTSSPSTTTTLPPANLNSAPGPTGLTLTSPPRGQARE
TLKPTSTSALPGRKSVNSQNKLSARPRTTPRFPSNKSDRWCSVTFTTDWCARTRTSTAVL
RCASTTGSASSAAGLTPVQTTTPTTSPTTTISTGTSSSTTPTLSVTTSTSTATPTTTIET
STSTSTLTPTPTLISTTTRPTLPPANLNSAPGPTGLTLTSPPRGQARETLKPTSTSALPG
RKSVNSQNKLSARPRTTPRFPSNKSDRWCSVTFTTDWCARTRTSTAVTITPTTSPTTTIS
TGTSSSTTPTLSVTTSTSTATPTTTIETSTSTSTLTPTPTLISTTSSPSTTTHVTACELE
LCSWTDWFDVDFPSSGTSQGDFETYQHIRAAGKEVCQQPKQIECQAEDYPEISIEQVGQV
VQCDVHYGLVCKNQDQHGSFKMCLNYRIRVLCCRPNPDCVQTITPTTSPTTTISTGTSSS
TTPTLSVTSSTMSTIFSTSTSISTPCFFSWFCVVCSETCTIERYTGDCNFTTPVTTTSPQ
TPTIITSRPTLPPGCVSSTHPPLQVCRFCAMIIEITSVLALYQKGMSKTWNSKKKTKPNQ
TNKQTKKPKQTDKQTNKHTIVQQTWYTSRAGPLILLPAAKDGTTHVLKVLQTGKLGNDSS
PSHSAEGKSKCPCGIKTKKKKLRRNSTYTAEQLKSAELPPKFTKLKNCSASGSVNFPQSF
SSFSLTYPYPSISSNSLHPVSSPILPRHSPYMFPLVLPSLPISVSSFHLPLSSVRSDHSC
IPLLMAAAAKGKEIRNSEGTGVRTAVENTALHTIGCCFLTEPASSHATTPAKETGQKTNP
ALIPPMHLGSHPRYRHPPHLPHMSSKSTNSASENSSLYQRKALLPLRITCSPLLKTPVKM
GFDIWCLSLNWTDLISRCPKPLNIATIVSIRTSSALLCTRKLFVLCNANPIPGVHIQTIG
QVLSCILSFLYICTRKQKQGKLVQCTKSEGPFADCHYLLNPSTYYTNHCGKSDTVNGTFQ
VITENIPCGSTGTTCSKSIKVFLEPWSCSVAEETNGCFSGISKPKISSVGIFGTHALPTL
IESPGQRSSVASSTAMSLLPVTHSFTLYISLGLIEITTTPFTFSTSQPATEPEHLHYSSK
TTTPAQTVCVNNYKSCSKTTPSQTEQTTSTTTETTAITIQTKIKPSTTKEGPKPQEKQTT
TISTTIGSAASTTTSVLPKESMTTTGSTSAGTTTPTSSVSTTKTTPPVTESTTTIVTATS
SVTSSPTSTVTTFSSTSTTPATPPSTGQTQTTAKPATVTSVSTLSETTTTSTTVVTKTTS
LPTTGPTTTTAGSTTKSVPVSTEGTSTIASTILQSTVPTSSASTTKTSPPPTKGTTTIAS
TSAGTTTPTSSASTSKTTPPVIGSTTTIVTTTPIVTSSPTTTFTTSSPPTTHLPATLCLD
TVISQALVARVETLRPLQISVQLVMTCAPSHRTSGAVLKTTLTGACRVWTRNSSAASGTS
TIASTILQSTVPTSSASTTKTSPPPTKGTLTIASTSAGTTTPTSSASTSKTTPPVIGSTT
TIVTTTPIVTSSPTTTFTTSSPPTSTCQPRCAWTQWFDVDFPSAGSQGGDFETFANIRAA
GYDLCSQPQDIRCRAENYPDRSLQSLDQKLKCSLDVGLECRNKDQNSKYPMCFNYQVSVL
CCDHQHCLTTLTTPGTTPSTTTGTTTATPTTGLPTTTIPTVSAGSTLSETTTTSTTVVTK
TTSPLTTGPTTTTAGSTTKSVPVSTEGTSTITSTSAGITTPTSSVSTTKTSPPPTESTTI
IASTSAGTTTPTSITSTTKTTPPVTESTTTIVTATSSVTSSPTSTATTFSSTSTTPATPP
STGQTQTTAKPPTVSSVSTLSETTTTSTTVLTKTTSPPTTGPTTTTAGSTTKSVPVSTGG
TSTITSTILQSTVPTSSASTTKTSPPPTKGTTTIASTSAGTTTPTSSASTSKTTPPVIGS
TTTIVTTTPIVTSSPTTTFTTSSPPTSTCQPRCAWTQWFDVDFPSAGSQGGDFETFANIR
AAGYDLCSQPQDIRCRAENYPDRSLQSLDQKLKCSLDVGLECRNKDQNSKYPMCFNYQVS
VLCCDHQHCLTTLTTPGTTTSTTTGTTTATPTTGLPTTTIPTVSAGSTLSETTTTSTTVV
TKTTSPPTTGPTTTTAGSTTKSVPVSTEGTSTIASTILQSTVSTSSASSPVTSPVTESTA
TTILAPTQTTAAASSSATTRVSPILTGHSTAIASTRTNNASTTKISPSVTVFTIPSSASS
LPSSSTILTPTSISTVVKQTTAQSPTSSRSVSTYHSKWNKAVLFSTAGTSQPSHITSTSA
FSSSSLTTPSTTVGPCPSTTPLTSVSSETTTQASSSTEHISSSISSTTATS
Download sequence
Identical sequences ENSGALP00000010853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]