SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000010977 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000010977
Domain Number 1 Region: 119-181
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 266-325
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000612
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 81-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000361
Family Complement control module/SCR domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000010977   Gene: ENSGALG00000006796   Transcript: ENSGALT00000010991
Sequence length 468
Comment pep:known_by_projection chromosome:Galgal4:4:5150002:5155096:-1 gene:ENSGALG00000006796 transcript:ENSGALT00000010991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGPGMAQEAAPVLLVFLTRLVSATWHEGSGYYTAESHTNEVYVEEAPPEPALDYRRVPQ
WCATLNIYRGEATCYSPRGGNYRSSLGTRCELSCARGYRLVGRSAVQCLPSRHWSGMAYC
RQIRCHVLPAVLRGSYVCSAGVQMDSRCDYTCLPGYQLEGDRSRTCMEDGRWSGSEPICV
DVEPPKIRCPESRERIAEPGKLTATVYWDPPRVKDSADGIIKRVTLRGPEPGSEFPEGEH
VIRYTAYDQAYNRASCKFRIRVQVRRCPVLKPPQHGYLSCTSDGNNYGATCEYLCDGGYE
RQGTSLRVCQSTQQWTGSSPLCAPMQINTAVNSAASLLDQFYEKRRLLVISAPDSANRYY
KMQISMLQQATCGLDLRHVTIIELVGQPPHEVGRIREHQLSVGIIEELRQFLHLTRSHFN
VVLLDKAGTDRERYILPISPDELFDFIDTYLLSEQETAQRAQRGDPCD
Download sequence
Identical sequences ENSGALP00000010977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]