SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011236 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011236
Domain Number 1 Region: 29-121
Classification Level Classification E-value
Superfamily Kringle-like 1.33e-22
Family Kringle modules 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011236   Gene: ENSGALG00000006942   Transcript: ENSGALT00000011250
Sequence length 267
Comment pep:known_by_projection chromosome:Galgal4:15:9045929:9052604:1 gene:ENSGALG00000006942 transcript:ENSGALT00000011250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSAPRMLRGGPLRALGAVLLGSLLLAAARGAEECLRGDGASYRGNRRVASGGAPCLNWLA
VRSETGAALPAVAEDHDSCRNPNGDAAPWCYVRGAAGIPERRTCEIPPCPDATATTAPVP
TAEVNVSQEVNQVFEPADTLPSRSEAAAVQPVIGISQRVQMNSREKKDLGTLGYVLGLIM
MVIIIAIGAGIVVGYIYKRGKDLKEKHEQKVYEREMQRITLPLSAFTNPACELVDENTIV
VHTNQTPVEDTHDGSGPLMGQAGTPGA
Download sequence
Identical sequences ENSGALP00000011236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]