SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011434 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011434
Domain Number 1 Region: 222-442
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.55e-50
Family Reprolysin-like 0.0046
Further Details:      
 
Domain Number 2 Region: 535-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000249
Family TSP-1 type 1 repeat 0.00051
Further Details:      
 
Domain Number 3 Region: 966-1023
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000863
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 860-916
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0052
Further Details:      
 
Domain Number 5 Region: 919-962
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 6 Region: 797-856
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000471
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011434   Gene: ENSGALG00000007069   Transcript: ENSGALT00000011448
Sequence length 1087
Comment pep:known_by_projection chromosome:Galgal4:10:16601477:16763501:-1 gene:ENSGALG00000007069 transcript:ENSGALT00000011448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFDGCLLPLVFPCLLLWGLDAGTAGGAELEVVIPERVALERIHLLPPAGRGDRGGARRRR
ELLRPREAAGEALLLRLPAAGTELYVHLRRDLRFLSRGFVVEHRRGEERRPPAERLCFYT
GRVLNRSDSFASLSTCAGLKGGYVGYIQIGSEHMLIQPVNTSETSFSGKEHFIRRRRSTK
SSHSLKSQIPDEHCKVVAEKKRQKKMKSTSDWRERRNAIRLTNEYTVETLVVADADMVQY
HGAEAAQRFILTVMNMVYNMFQHQSLGIKVSIRVTKLVLLRSRPAKLSIGHHGERSLESF
CHWQNEEYGGAKYLGNNQVPGARDDTPPVDAAVFVTRTDFCVHKDEPCDTVGIAYLGGVC
SAKRKCVLAEDNGLNLAFTIAHELGHNMGMSHDDDHPPCAGRSHIMSGEWVKGRNPSDLS
WSSCSRDDLENFLKSKVSTCLLVTDPRSQYAVRLPHKLPGMHYSADEQCQILFGTNATFC
KNMEHLMCAGLWCLVEGDTSCKTKLDPPLDGTECGADKWCRAGECVSKTPIPEHVDGDWS
VWSQWSMCSRTCGTGVRFRQRKCDNPPPGPGGKNCRGASVEHTVCENLPCPKGVPSFRDQ
QCQAHDRYTNKKKSLLTAVVVDDKPCELFCSPLGKDSPVLVTDRVLDGTPCGPYETDLCV
HGKCQKIGCDGIIGSAAKEDRCGICSGDGKTCKVVKGDFNHTKGMGFKDSSKRSINSDWK
IELPGEFQIAGTTVRYVRRGLWEKISAKGPTKIPLHLMLNQVLLFHDQNYGIHYEYTIPV
NYTANRSEPEKQQDSLYIWTHSGWEGCSVQCGGGERKTIVSCTRIINKTMTVVNDSNCQR
VNRPEPQVRKCNTHPCQSRWVTGLWSPCSATCEKGIQHREVTCVYQLQNGTYVNTRDLYC
LGNKPATVQSCEGRDCLSIWEASEWSKCSADCGKGIQKRTVTCTNSQGKCDAATRPRDEE
ECEDHTGCYEWKTGDWSKCSSTCGKGLQSRVVQCMHKVTGRHGSECPVLSKPAAYRQCHQ
EVCNEKINVNTITSPRLAALTYKCTGDQWTVYCRVIREKNLCQDMRWYQRCCQTCRDFYA
NKMQQKS
Download sequence
Identical sequences ENSGALP00000011434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]