SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011886 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011886
Domain Number 1 Region: 192-280
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000503
Family I set domains 0.075
Further Details:      
 
Domain Number 2 Region: 33-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.002
Further Details:      
 
Domain Number 3 Region: 108-182
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000981
Family Pre-dockerin domain 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000011886
Domain Number - Region: 375-434
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00746
Family Carboxypeptidase regulatory domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011886   Gene: ENSGALG00000007358   Transcript: ENSGALT00000011900
Sequence length 1059
Comment pep:known_by_projection chromosome:Galgal4:10:17290315:17300075:-1 gene:ENSGALG00000007358 transcript:ENSGALT00000011900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSLEGRRSSSRRLDPIFTNARRTVLVQDSRKFLSPWSKWSECSGKCGQTGVQKRTRSCL
ADRLWGVHCNEVMEEGRLCIGHVCSGCNITCPMGRVNADCDACMCEDVTLHGKVSLEDGS
PADNARVYLQANNLKLLTTADNKGTFRIPGVCPDGKNTLKIKKAKYTTTAITVPETNRKN
LAFQVQLKRSGKPYVFKSPDDKARRVGQSVSLCCNAVGTPAPDRYLWYHNGSLLDPSIYR
YKNNLILKNLNRGQAGEYFCKAVSDGGSAKSQPAMLSVIGKQEAACSSQPQSHLIHLPHD
CFQKATDSFYYDVGKCPAKTCVGKLDKGLRCKDNISYCCGVSKMEVREILCDGYTLPTKV
AVECGCKKCTETKITVRGRATAVDNGEPLRFGHIYMGNKRVSMTGYKGTFSVHVPPDTER
LVLTFVDRLQKFVNTTKVLPFKENGGAVFHDIKLLRKKAPVMLESTETSVIPLGEKEDDD
PIAELEIPPDSFYRKNGEPYRGKVKASVTFLDPRELSTAPVTQSDLNFVDDEGDVFPLRT
YGMFSLDFTDEQGTETLNVEDVKVHLDTAQVRMPEHLQEMKLWSLNPETGLWEEEGDFNL
EKSRRRRREERTFLVGNMEIKERRLFNLDVPENRRCYVKVRAYRSERFLPSEQIQGVVIS
VINTEPEPGFSSNPRAWGRFDSVVTGPNGACVPAFCDEQNPEAYAAYILASLGGEELEAV
PSAPKLNPNAIGVPQPYLNKLNYRRTDHEDPNTKKTAFRINMAKPSPNSADENNGPIYAY
ENLKECEEAPYSAAHFRFYRIEGDRYDYNTVPFSEDDLMSWTDDYLAWWPKPMEFRACYI
KVKINGPQEVNIRSRNMGGTHPRTIGKLYGIRDVRSIRDPEQQDVSAACLEFKCSGMLFD
QDRVDRTLVKVIPQGSCRRESVNSMLHEYLVNHLPMATNNDSSEYTMLAPLDPLGHNYGI
YTVTDQDPRIAKEIALGRCFDGTSDGTSRIMKSDIGVALTFTCSERSAAEQSLFESQRNL
GQQSIQVPPRESPAYQRPVGSRQITQSRIQMRGQRPSSY
Download sequence
Identical sequences ENSGALP00000011886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]