SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011941 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011941
Domain Number 1 Region: 280-490
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.45e-57
Family Reprolysin-like 0.00094
Further Details:      
 
Domain Number 2 Region: 579-635
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000017
Family TSP-1 type 1 repeat 0.0004
Further Details:      
 
Domain Number 3 Region: 1174-1232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000157
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 
Domain Number 4 Region: 1380-1437
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 5 Region: 1099-1158
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000114
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 
Domain Number 6 Region: 1227-1288
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000863
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 7 Region: 1609-1669
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 1442-1496
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 9 Region: 1327-1381
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 10 Region: 1675-1723
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000262
Family TSP-1 type 1 repeat 0.0038
Further Details:      
 
Domain Number 11 Region: 985-1046
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000772
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 1046-1101
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000955
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 13 Region: 1544-1606
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000101
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 1494-1548
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 15 Region: 870-926
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000536
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000011941
Domain Number - Region: 932-986
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0131
Family TSP-1 type 1 repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011941   Gene: ENSGALG00000007392   Transcript: ENSGALT00000011955
Sequence length 1929
Comment pep:known_by_projection chromosome:Galgal4:12:13713809:13779455:-1 gene:ENSGALG00000007392 transcript:ENSGALT00000011955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLAPLALALTTLFIDGLRTGARRQKLHPRQAKLLEKLSEYEIVTPTRVNEFGEPFPTDV
HFRRRRRSTNAAPDAWTAAAASSSSSPKAHYRLSAFGQQFLFNLTASSAFIAPLFTVSIL
GEPAAEQRNLYAETADTDVKHCFYRGHVNARPRHTAVISLCSGMLGTFKSDDGDYFVEPL
LSLEQEYEEEHNKPHLVYRHRTPPTNSSGDRQTCDTPDHEHSHKKSKRKHWRKQWVESSL
LSDTEMLKHSLEVNPFSADSNETGNASEKKSHRRTKRFLSYPRFVEVMVVADSRMVAYHG
ANLQHYVLTLMSIVASIYKDPSIGNLINIVIVKLVVIHNEQDGPAISYNAQTTLKNFCQW
QQSQNHPEGSHLQHDTAVLVTRQDICRAHDKCDTLGLAELGTVCDPYRSCSISEDNGLST
AFTIAHELGHVFNMPHDDNHKCKEDGGKNQQHVMAPTLNFYTNPWMWSKCSRKYITEFLD
TGYGECLLDEPSSRTYALPQQLPGLIYDVNKQCELIFGPGSQVCPYMQMQCRRLWCINID
GAHKGCRTQHTPWADGTECEPGKHCRFGMCVPKEREAPVVDGAWGTWSPFGTCSRTCGGG
IKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCSKLKKDFRDEQCADFDGKHFNINGL
PTNVRWVPKYSGILMKDRCKLFCRVAGNTAYYQLRDRVIDGTPCGPDTNDICVQGLCRQA
GCDHVLNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNVVVRIPAGATNIDVRQHSYS
GKPEDDNYLALSNSQGDFILNGDFVVSMFKREIKVGNAVIEYSGSDNAIERINSTDRIEQ
EITLQVLSVGNLYNPDVRYTFNIPIEDKPQQFYWNAYGPWQPCSKLCQGERKRKPVCTRE
SDQLTVSDQRCDRIPQPDPITEPCGTECELRWHIARRSECTAQCGLGYRMLEIYCSKYNR
LEGKTEKVDDRFCSSQAKPSTREKCTGDCNVGGWRYSAWTECSKSCGGGTRRRRAMCVST
YNDVLDDSKCSQQEKLTVQRCSDFLCPQWKTGDWSECLVTCGKGHKHRQTWCQFGEDRLN
DRFCDPETKPESVQTCQQQECAAWQVGPWGQCTMTCGQGYQMRAVKCVVGTYMSVVDDNE
CNAATKPTDTQDCEIAACPPHPNSPEAKRSVSGVHRTQWRFGSWTPCSATCGKGTRMRYV
SCRDEQGSVADESACFHLPKPSATEMCTVTPCGQWKALEWSSCSVTCGQGKATRQVICID
YSDQLVDRSECDPDDLPATEQDCSMSPCHPNSHDYGRPIHPFLYPDHRLKLHPGGSPNRN
RAHIPGGNQWRIGPWGACSSTCAGGFQRRVVVCQDENGYTANNCDEKTKPMEQRSCESGP
CPQWAYGNWGECTKPCGAGTRTRLVVCQRPNGERFTDLSCEILDKPPDREQCNVQDCPRD
AAWSAGPWSSCSVSCGRGQRHRTVYCLTKEGRHVEEDYCKHLVKPNVQKKCRGGRCPKWK
SGDWGQCSVSCGRGVQQRAVQCHGGAPTAACDPASQPAAQRDCQLPECPTHRWAAGEWQA
CLKTCGEAVRYRKVFCVDESKQVQSSAHCDASKRPLEMESCGLPPCEYIWITGEWSECSV
TCGKGYRQRLVSCSEIYTGKDHYEYGYQNTVSCPGTQPPNIQPCYLGECPVSASWRVSNW
GSCSVTCGVGVMHRSVQCLTNDDQLSSLCHADLKPEERRTCHNVHDCELPRSCNDVKSLK
GVTEDGEYFLKVKGKTLKVYCSGMQTDSPKEYVTLVNGDAENFSEVYGYRLHNPTECPYN
GSRREDCQCRKDYTAAGFSTFSKVRLDLNTMQIITTDLQFSRTHDGRPVPYATAGDCYSA
AKCPQGRFSIDLYGTGLSLTGTAKWLSQGNYAVSEIQKSPDGTKVVGRCGGYCGKCTPSS
GTGLDVQVL
Download sequence
Identical sequences ENSGALP00000011941 XP_004944721.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]