SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011986 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011986
Domain Number 1 Region: 398-715
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.31e-77
Family Eukaryotic proteases 0.0000699
Further Details:      
 
Domain Number 2 Region: 20-135
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-33
Family Spermadhesin, CUB domain 0.0000193
Further Details:      
 
Domain Number 3 Region: 181-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-29
Family Spermadhesin, CUB domain 0.0000152
Further Details:      
 
Domain Number 4 Region: 298-364
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000195
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 5 Region: 131-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000255
Family EGF-type module 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011986   Gene: ENSGALG00000007419   Transcript: ENSGALT00000012000
Sequence length 729
Comment pep:known chromosome:Galgal4:9:14339432:14355179:1 gene:ENSGALG00000007419 transcript:ENSGALT00000012000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYPLAWSMCAWLLGVVGAVELTDMFGEIRSPNFPDSYPSDSEVTWNISVPEGFKIKLYFM
HFDLESSYLCEYDYVKIEAEDHELATFCGRETTDTEQAPGQQVILSPGPYMGLTFRSDFS
NEERFTGFDAHYTAVDVDECLEKSDEELACDHYCHNYIGGYYCSCRFGYILHSDNRTCKV
ECSDNLYTQRSGVVTSADFPSPYPKSSDCLYRIELEDGFFITLSFEDSFDVEDHPEVTCP
YDYIKIKAGQREFGPFCGEKSPGRIETQTNSVQILFHSDNSGENRGWKLSYTAIGNPCPL
VQPPINGKIEPSQAKYTFKDQVVISCNTGYKVLKDNLESDSFQIECLKDGTWSNKIPICK
IADCQAPPELEHGFVTFLSRNNLTTYRAAIQYHCQHPYYHMAPNSTATYTCDASGVWRSE
ELGTVLPSCRPVCGRPVRALPGIIKRIIGGRNAEPGFFPWQALIVVEDMSRVPNDKWFGS
GALLSDSWVLTAAHVLRSQRRDKTVIPVSKEHVTVYLALHDVRNKLEAVNRTVERIILHE
DFDIQNYNHDIALVKLKEKVTMGNYVMPICLPQFEHELEGPHPNTLGLVAGWGISNPNIT
VDEIISSGMRTLSDILQYVKLPVVLHAECKTSYESRSGNYSVTENMFCAGYYEGGKDTCL
GDSGGAFVIQDPGTRRWVAQGLVSWGGPEECGSKQVYGVYTKVSNYVDWVEKNTGSSERW
TFLDPELER
Download sequence
Identical sequences ENSGALP00000011986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]