SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000011990 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000011990
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-27
Family C-type lectin domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000011990   Gene: ENSGALG00000007420   Transcript: ENSGALT00000012004
Sequence length 152
Comment pep:known chromosome:Galgal4:5:16325506:16327147:-1 gene:ENSGALG00000007420 transcript:ENSGALT00000012004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRLLLVLTLLGMVSALCPGPWHAMEVPECREGSGRCFAVVKARRTYRAAQCYCRKVYK
GQLASVHSTATNEQLRKLAATYTYCSLWIGAVTTCKGGSWKTSWQDLSSWNYANWAIGQP
CRRFRTCTVLSPKDGLWRSRACFLLRPFICQY
Download sequence
Identical sequences A0A1L1RYE4
9031.ENSGALP00000011990 ENSGALP00000011990 ENSGALP00000011990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]