SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000012057 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000012057
Domain Number 1 Region: 42-92
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000377
Family Viral proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000012057   Gene: ENSGALG00000007465   Transcript: ENSGALT00000012071
Sequence length 383
Comment pep:known chromosome:Galgal4:6:21644626:21648594:1 gene:ENSGALG00000007465 transcript:ENSGALT00000012071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTLCCGGGRFFRLGPSLVPLRQPPRRGLPQQPAPAVPPAVGRWLLACSGAVAGAVVLG
GVTRLTESGLSMVDWHLVKEMKPPRTQQEWEAEFQKYQQFPEFKILNHDMTLTEFKFIWY
MEYSHRMWGRVVGLAYILPAAYFWRKGWLSRPMKGRVLALCGLVCFQGLLGWYMVKSGLE
EKPDSHDIPRVSQYRLAAHLGSALVLYAASLWTGLSLLLPRHQLHETRQLLQLRHFAHGT
TALIFLTALSGAFVAGLDAGLVYNSFPKMGERWIPDDLLAFSPTLRNIFENPTTVQFDHR
ILGTASVTAVTALYLFSRKISLPHRTRIAVTSLLAVAWVQVGLGISTLLLYVPTPLAATH
QSGSLALLSVALWLMSELRRMPK
Download sequence
Identical sequences F1NMU0
NP_001107598.1.86415 ENSGALP00000012057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]