SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000012731 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000012731
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily C-type lectin-like 4.63e-38
Family Link domain 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000012731   Gene: ENSGALG00000007849   Transcript: ENSGALT00000012746
Sequence length 396
Comment pep:known chromosome:Galgal4:5:18248884:18303314:1 gene:ENSGALG00000007849 transcript:ENSGALT00000012746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANFYLLATFGLCLLKFCLTETQFNITCRYGGVFHVEKNGRYSLTRAEAIELCRALNSTL
ATLEQFERAHALGFETCRYGFIVGHIVIPRINPYHLCAANHTGIYKLSANTTGRYDAYCY
NATETRSKACEPIERIDITFLSNQSEIVIDNEDGSRYNADGTRHSGDSSTSGVDDENLGS
GSIHDTTPGDASIRRSSPSYYGSVTPYSHMPDHSSGGGEKDFPVKHYDDEISPTSTDILA
TAADFPREDDVQHPASTRSTSNIDSDQGPHKGDGEPTSSPGLSTTTTVTSQPGTAHVPEW
LIIVAALLALALILAVCIAVNSRRRCGQKKKLVINNGKGAVEDRKTRELNGDASKSQEMV
HLVHKEQSNDRTGACDEFLTVDETQNHQDGDMKSGV
Download sequence
Identical sequences A0A1D5PBN1
ENSGALP00000012731 NP_990191.2.86415 ENSGALP00000012731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]