SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gallus gallus 76_4 > ENSGALP00000012805

Domain assignment for ENSGALP00000012805 from Gallus gallus 76_4

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGALP00000012805
Domain Number 1	Region: 25-61
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000602
Family	LDL receptor-like module	0.0012
Further Details:

Domain Number 2	Region: 106-143
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000301
Family	LDL receptor-like module	0.001
Further Details:

Domain Number 3	Region: 66-103
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000654
Family	LDL receptor-like module	0.0013
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGALP00000012805 Gene: ENSGALG00000007895 Transcript: ENSGALT00000012820
Sequence length	349
Comment	pep:known_by_projection chromosome:Galgal4:5:18566514:18666428:1 gene:ENSGALG00000007895 transcript:ENSGALT00000012820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MWLLWLLLGSADSQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDDSDEKEC PKAKSKCGATFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARFHCKNGL CIDKSFVCDSQNNCQDNSDEESCESPQEAGSGQDYVTSENQLLYYPSITYAIIGSSVIFV LVVAFLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCSVTYNVNNGIQYMSN QTYHRPVDLDSPPSYSEAVLDQSRPPWFDLPPPPYCSESESPNQPDLPPYRSRTGSMVSP GTPTAGSSLGTDSGWTRDVHESTDGHRTLLERTADPSDSLVNHVDEREV
Download sequence
Identical sequences	ENSGALP00000012805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]