SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000012805 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000012805
Domain Number 1 Region: 25-61
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000602
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 106-143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 66-103
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000012805   Gene: ENSGALG00000007895   Transcript: ENSGALT00000012820
Sequence length 349
Comment pep:known_by_projection chromosome:Galgal4:5:18566514:18666428:1 gene:ENSGALG00000007895 transcript:ENSGALT00000012820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLWLLLGSADSQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDDSDEKEC
PKAKSKCGATFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARFHCKNGL
CIDKSFVCDSQNNCQDNSDEESCESPQEAGSGQDYVTSENQLLYYPSITYAIIGSSVIFV
LVVAFLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCSVTYNVNNGIQYMSN
QTYHRPVDLDSPPSYSEAVLDQSRPPWFDLPPPPYCSESESPNQPDLPPYRSRTGSMVSP
GTPTAGSSLGTDSGWTRDVHESTDGHRTLLERTADPSDSLVNHVDEREV
Download sequence
Identical sequences ENSGALP00000012805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]