SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013074 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013074
Domain Number 1 Region: 90-285
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.65e-54
Family Astacin 0.0000462
Further Details:      
 
Domain Number 2 Region: 287-398
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.77e-29
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013074   Gene: ENSGALG00000008061   Transcript: ENSGALT00000013089
Sequence length 409
Comment pep:known chromosome:Galgal4:5:21649227:21661084:1 gene:ENSGALG00000008061 transcript:ENSGALT00000013089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKMLLIFIAFLLPSVLGFPIQDNYENSTATTESTQVTTEEDIYDSPSPAETDSEDELI
FNRILEVNKDSSQYLQEGDIVPRRSRSAINCRNCYWPQSRDGIVRIPYVLDPTYEENHVK
GIREAMAEFETLTCINFVKRKTERDYLIIRSADGCWSNYGKVGGGQTISVMKGGCMWKGI
IQHELDHALGFLHEHSRSDRDKYVRIMWEYISPADRPDFKKFENSNNLGLPYDYSSVMHY
GPHTFTNTTGKATIVPVPDGSVHIGQRLGLSNLDVAKINRLYNCSRCSTIIDAAFGSLKS
ANYPRNYSDNTNCVWLIRTRSRKISLHFRAFELRTTRGCQGDYVKVYDGSSKYSTVLMDK
TCGSQIPTDVVSSSNLMLIEFVTDGADTASGFQATFTSAKIQRRFKIRN
Download sequence
Identical sequences P0DJJ2
ENSGALP00000013074 NP_001292019.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]