SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013090 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013090
Domain Number 1 Region: 260-328
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000523
Family VWC domain 0.0083
Further Details:      
 
Domain Number 2 Region: 115-182
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000711
Family VWC domain 0.025
Further Details:      
 
Domain Number 3 Region: 36-103
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000201
Family VWC domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013090   Gene: ENSGALG00000008072   Transcript: ENSGALT00000013105
Sequence length 456
Comment pep:known chromosome:Galgal4:4:13471386:13513129:1 gene:ENSGALG00000008072 transcript:ENSGALT00000013105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRKWRSEDFHFVFFGVLCLLLIDRGKLEQVKHSDTYCVFQDKKYRVGERWHPYLEPYGL
VYCVNCLCSENGNVLCSRIRCPILHCPSPVHVPQLCCPRCPEDSLFSVSSKITGKSCEYN
GTTYHHGEMFVAEGLFQNRQANQCAQCSCSEGNVYCGLKTCPKLTCSFPVSVPESCCPVC
RGDGELSWEQADGDIFRQPANREARHSYHRPHYELSPSSTRQVVNVPRFPSARSNRGVLP
DPQQASGTIVQIVINNKHKHGRVCVSNGKTYSHGESWHPNLRAFGIVECVLCTCNITKQE
CKKIHCPEQYPCKYPQKVEGKCCKVCPEEVPSQSFDNKDYFCGKETFPVYESIFTEEGET
IRKIAVETEKPPQIEIHVWTIRKGILRHFYIEKMSKREFEELPYFKQITRTTSSQWKIFS
EGEAQISQMCESRVCRTELEDLVKVLYLEKSEKGHC
Download sequence
Identical sequences F1ND76
ENSGALP00000013090 XP_015133639.1.86415 XP_015133640.1.86415 9031.ENSGALP00000013090 ENSGALP00000013090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]