SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013206 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013206
Domain Number 1 Region: 547-659
Classification Level Classification E-value
Superfamily C-type lectin-like 7.06e-48
Family Noncollagenous (NC1) domain of collagen IV 0.00000145
Further Details:      
 
Domain Number 2 Region: 435-544
Classification Level Classification E-value
Superfamily C-type lectin-like 2.17e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013206   Gene: ENSGALG00000008141   Transcript: ENSGALT00000013221
Sequence length 660
Comment pep:known_by_projection chromosome:Galgal4:4:13861296:13934946:-1 gene:ENSGALG00000008141 transcript:ENSGALT00000013221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPGPPGSKGSQGIAGRPGQPGPAGFPGLKGEKGDPGLSSIGIPGLPGPKGDLGLPGYP
GSPGSKGIAGNPGLPGLPGSPGAKGEPGLPGFPGTPGIPGPKGIEGPPGNPGLPGPPGPV
GDTGRPGPPGPPGEKGQPGRDGIPGPAGQKGEPGLPGFGRPGPPGLPGLSGQKGELGLPG
PPGPPGLPGLKGEPGFQGFPGLQGPPGPPGLPGPPLEGPKGSPGPPGVPGRPGPPDDKGS
PGPEGPRGPPGSGGLKGEKGNPGQPGPPGLTGQKGDQGPPGRQGDPGRPGLNGMKGDPGV
PGVPGFPGMKGPTGPAGPAGLTGSQGLPGPPGPPGLPGTIGRSIVVKGDPGPPGPPGLPG
SKGPPGLAGPQGLPGPVGVPGDPGRDGLPGFDGPAGRKGERGLPGQPGSRGIQGPPGPDG
LQGPPGPPGTASVAHGFLITRHSQTRDTPLCPQGTSRIYDGFSLLYVQGNERAHGQDLGT
AGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMEPLTGQNIQPFISRCV
VCEAPAMVIAVHSQTIQIPSCPPGWDSLWIGYSFMMHTSAGAEGSGQALASPGSCLEEFR
SAPFIECHGRGTCNYYANSYSFWLATVEVSEMFSKPQSETLKAGDLRTRISRCQVCMKKT
Download sequence
Identical sequences ENSGALP00000013206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]