SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013251 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013251
Domain Number 1 Region: 307-518
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.09e-60
Family Reprolysin-like 0.00086
Further Details:      
 
Domain Number 2 Region: 605-660
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000458
Family TSP-1 type 1 repeat 0.00025
Further Details:      
 
Domain Number 3 Region: 1663-1722
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000209
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 891-947
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 5 Region: 1010-1062
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000405
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 1552-1615
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.008
Further Details:      
 
Domain Number 7 Region: 1610-1664
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000157
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 8 Region: 1507-1557
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 9 Region: 942-1009
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000902
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013251   Gene: ENSGALG00000008164   Transcript: ENSGALT00000013266
Sequence length 1784
Comment pep:known_by_projection chromosome:Galgal4:10:19166391:19211028:1 gene:ENSGALG00000008164 transcript:ENSGALT00000013266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTLLLSTVRRSGLPVLNAVPLTRRPRGVTPELRRQPRDSGGAGPGERRRRQRGGPAGRE
TLSARPGPALPAPMPAPGRLLLLAAALAAGVQRSSGTEQPEPALWTSSSDIVHPVKVDER
GSFLSYDLSHRALHRRSLSSKNKFLAFYELHYKGQPLKFNLSLNVNLLTPGFVSERRYGG
ITDAKIQSHTYNSCHMIGEVQSRTLKGGLAALSTCDGLKGVFRLMNEDYFIEPVATSFPE
DAAAQPHRIYKRHAPEHPGEQDKKQPAAWAACGVQESQESLEKFEKRRERWEQKQYRKRR
IKQRSISKEKWVETLVVADTKMIEYHGSENIEKYVLTVMNMVAGLFHHASIGNPINIAIV
RLILLENEEENLKISHHADNTLKSFCKWQKSINVKGDSHPLHHDVAVLLTRKDICAAMNR
PCETLGLSHVAGMCQPHRSCNINEDTGLPLAFTVAHELGHSFGIQHDGSSNDCEPVGKRP
FIMSPQLLYDTSPLTWSRCSREYITRFLDRGWGLCLDDPPAREVLDFPLVPPGVLYDVSH
QCRLQYGAYSTFCDDMDSVCNTLWCTVGTTCHSKLDAAVDGTTCGENKWCFNGECVPVGY
RPDAIDGSWGPWSSWAACSRSCGAGVQSAERQCSNPTPKYGGRYCLGERKRFRICNIKPC
PPNKPSFRQVQCSQFNPMPYKGKLYKWTPVPNNINPCELHCRPEDEYFAEKLRDAVIDGT
PCYEMNSSRDMCINGICKNVGCDYEIDSNAVEDRCGVCHGDGSTCHTVKKTFEDSEGLGY
VDIGIIPVGAREIRIEEVAEAGNFLALRSEDPEKYFLNGGWTIQWNGDYRVAGTTFTYER
TGNWENLTSPGPTVEPVWIQLLFQETNPGVRYQYTIQRPADSENEIKQAEFLWRFGSWTT
CTATCGTGVQRQIVHCVEKLAGIVEERYCDTLTRPDDQQRTCNEEPCPARWWVGEWQKCS
ATCGTSGLMKRTVLCIQSVGLDEQRALQQADCQHLSKPEATAPCHRDVPCPSQWAVGNWS
ECSATCGNGTQRRPVYCSNNTQATCDPAQRPSSETICSLPQCQKKLDNANTDWSGSGSSS
REIFNEIHYIPNNHIPQFNPIIPNIPESNDVNIITEDDFSTRKGNFFVDDFYYDYNFINF
HEDLSYYPFTEKETKSEGPKPERSSNGMSPEHEERGTATPSAAPALTRDEGEEVLVPYSK
DPLPTQPAVSHDSTSSLLLPKLSLGAALVGTSPAWDAPAHSLDSWAPTSPSTPLPIDRDS
AGAGSTPDGLQPVRESANRVQDHVSTAAPDRAGSTKKGHENSRDRVASNSPTAQSLQQEM
GRHAEGPNESPHPADATMGPGGEAGQQPGNHSPLSLTLAPLVATTTSLLPVPVSPTTLGL
STQLTAGGLIPQGALVPAMPASPAHSPPTGASPSKPSTVRGAEWRPRATQVPYHTVPASS
STQQRSSMSPISHSAPEEHSPPAAPGTLAYSAGEHEGPQPTPTLLALWEQEEALLLPPTT
IAATAMPSWEVGNWSECSATCGVGAIWRSVRCSTGIEQHCTAASKPVPARRCSLRPCSSW
RVGNWSKCSKNCGRGTKVRDVHCVDTREQRLLRPFHCQAVLYKPPAQLPCQNTPCLDWYM
SSWRECSEPCGGGEQERLVTCPELGHCDETLRPNNTRPCNTHPCTKWVVGSWGQCSVPCG
GGIQRRQVKCIDTQTGQAQEDSSLCDHEPWPESTQKCNLQNCEGTEAGFICERDRLTFSF
CQTLRVLGRCHLPTVRIQCCQSCRQHGHHRAPDQDRGDERASRR
Download sequence
Identical sequences ENSGALP00000013251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]