SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013432 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013432
Domain Number 1 Region: 1586-1699
Classification Level Classification E-value
Superfamily C-type lectin-like 1.25e-44
Family Noncollagenous (NC1) domain of collagen IV 0.00000159
Further Details:      
 
Domain Number 2 Region: 1479-1584
Classification Level Classification E-value
Superfamily C-type lectin-like 2.83e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013432   Gene: ENSGALG00000008266   Transcript: ENSGALT00000013447
Sequence length 1700
Comment pep:known_by_projection chromosome:Galgal4:4:13941226:14062603:1 gene:ENSGALG00000008266 transcript:ENSGALT00000013447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPAPGRAGALLLLLPVLLLCLRAEPASAGGKKSYSGPCGGRDCSAGCKCFPEKGARGRP
GPIGIQGPIGAPGFTGPEGLPGAKGERGAVGPPGPAGHKGNKGSMGVPGFQGINGIPGHP
GQSGPRGPPGLDGCNGTIGSPGVSGPDGFPGIPGLPGRPGPKGLKGEPVYAQGSLKGMKG
ENGLPGLDGISGPRGFPGPTGSAGPIGLPGLQGPVGPPGPPGPKGNMGLGFQGEKGEKGD
VGLPGPPGPPPSTGILEFMGFPKGKQGEKGQPGPQGLPGDKGLPGLPGFGGVGEKGEKGV
PGLPGGRGLLGLDGSNGIPGRKGHPGIPGYPGLDGVEGTKGEIGDIGPPGPPIVVDKEGV
VISGAPGDPGNPGIPGPPGDEGISGLPGFPGAPGFPGLERDGMGPGGSPGIPGVKGEMGE
PGRTTVGLPGTPGRIGLPGLPGAPGLPGSSRPSLLPDAILDGRTGAPGEPGQRGLPGALG
PKGYKGDAGDCACDGGVTRAGIKGISGPQGPPGSRGVPGIKGVSGDPGTVGAPGLRGPLA
SAGQQGLPGLKGEKGDSSYATGRGAPGDRGAAAPRGPSGFPGTPGRDGLPGLPGPPGPPG
DGGLGFPGEKGLPGLPGSKGRPGEIGSPGIGYPGPAGLRGPPGDPGMDGFPGQAGLPGPP
GITLPCVVPGAYGPPGTPGLPGLPGPKGSKGFPGIPGQPGLHGSKGQPGSPGIIGLQGEP
GFPGPRGEQGSQGLPGLDGTDGLPGKMGASGLAGTKGATGDVFGAESGAQGERGRPGLPG
DKGLAGDLGFPGPKGLDGRPGLLGIKGELGNPGYSGVPGLRGPPGPGGPFGIKGKPGPLG
SVGLAGAPGLPGVKGLSGDVGPQGPAGMKGFPGLDGAPGPPGERGFLGPPGPFGQDGRPG
FSGPKGEKGSSGLLGFPGMPGLPGVPGVNGFKGTPGAVGERGSPGVLGLQGQKGDRGDVG
PPGLPVLGAQEQALQLKGDKGDPGLAGLGGFPGPRGDKGIPGSRGQPGLPGPVGSASRER
GFHGDQGFPGPSGQPGLPGQKGTRGIIGFPGMPGERGSDGVTGTLGFPGPIGLPGPKGDQ
GESAGVPGTAGVKGERGDPGFPGERGREGLKGEPGYPGSTGVNGLKGGPGDLGPEGPAGI
PGNAGLRGISGPPGPPGQPGSVGFPGARGTAGPKGFHGFPGLNGLNGLPGTKGSPGTPGL
SEVGLKGPAGLPGLKGEEGSPGLGRGAVGFPGPKGSSGDLGPPGPVGLPGLPGTPGVSLP
SDIRGRPGDAGHPGLDGSSGLPGPPGQRGPPGPAFDQGDTGNPGFPGVPGLRGGKGDVGP
TGPIGLPGVSGFKGVRGEPGLMGMPGKDGPPGDPGYPGQKGGMGHRGLPGQPGAPGITPQ
AEEITAPAGLPGLPGIDGVPGFDGDPGFQGPVGKPGAKGLPGRSGLKGRDGLPGSPGIAG
DPGPVGAPGPQGFEGAAGKPGALGLPGMPGRSVGVGYTLVKHSQSDQIPPCPIGMNKLWD
GYSLLYVEGQEKSHNQDLGFAGSCLPRFSTMPFIYCNINEVCYYASRNDKSYWLSTTAPI
PMMPVDSNQIPQYISRCSVCEAPSQAVAVHSQDITIPQCPLGWRSLWIGYSFLMHTAAGA
EGGGQSLVSPGSCLEDFRATPFIECNGARGTCHYFANKYSFWLTTVEQSQQFVGAPPSET
LKAGQLRTRVSRCQVCMKNL
Download sequence
Identical sequences ENSGALP00000013432 XP_015134089.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]