SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013469 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013469
Domain Number 1 Region: 80-361
Classification Level Classification E-value
Superfamily C-type lectin-like 9.42e-103
Family Sulfatase-modifying factor-like 0.000000000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013469   Gene: ENSGALG00000008286   Transcript: ENSGALT00000013484
Sequence length 367
Comment pep:known_by_projection chromosome:Galgal4:12:18356412:18383474:-1 gene:ENSGALG00000008286 transcript:ENSGALT00000013484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLARGLPANMAAPAALRHLFLLLGAGLAVIAGAGKETAPGGNCGCSASRSRGGEREAVA
TVRRYSAAANDGRSSGRGPAPPKMVAIPGGVFTMGTDEPEIQQDGEWPARRVHVNSFYMD
QYEVSNQEFERFVNSTGYLTEAEKFGDSFVFEGMLSEEVKAEIHQAVAAAPWWLPVKGAN
WRQPEGPGSSILSRMDHPVLHVSWNDAVAFCTWAGKRLPTEAEWEYGCRGGLEKRLFPWG
NKLQPKGQHYANIWQGVFPTNNTAEDGYKGTAPVTAFPPNGYGLYNIVGNAWEWTSDWWA
VHHSADEAHNPKGPSSGTDRVKKGGSYMCHKSYCYRYRCAARSQNTPDSSASNLGFRCAA
DALPDPQ
Download sequence
Identical sequences ENSGALP00000013469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]