SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013544 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013544
Domain Number 1 Region: 334-604
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-86
Family Eukaryotic proteases 0.0000000197
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-30
Family Kringle modules 0.0000491
Further Details:      
 
Domain Number 3 Region: 201-288
Classification Level Classification E-value
Superfamily Kringle-like 7.97e-24
Family Kringle modules 0.00012
Further Details:      
 
Domain Number 4 Region: 45-106
Classification Level Classification E-value
Superfamily GLA-domain 1.31e-19
Family GLA-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013544   Gene: ENSGALG00000008332   Transcript: ENSGALT00000013559
Sequence length 607
Comment pep:known chromosome:Galgal4:5:22735982:22745887:-1 gene:ENSGALG00000008332 transcript:ENSGALT00000013559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHSKTTMLQGLLLFGLLHLTLSHDGVFLEKGQALSLLKRPRRANKGFLEEMIKGNLERE
CLEETCNYEEAFEALESTVDTDAFWAKYQVCQGTKMPRTTLDACLEGNCAANLGQNYRGT
INYTKSGIECQVWTSKYPHIPKFNASIYPDLTENYCRNPDNNSEGPWCYTRDPTVEREEC
PIPVCGQERTTVEFTPRVKPSTTGQPCESEKGMLYTGTLSVTVSGARCLPWASEKAKALL
QDKTINPEVKLLENYCRNPDADDEGVWCVIDEPPYFEYCDLHYCDSSLEDENEQVEEIAG
RTIFQEFKTFFDEKTFGEGEADCGTRPLFEKKQITDQSEKELMDSYMGGRVVHGNDAEVG
SAPWQVMLYKKSPQELLCGASLISNSWILTAAHCLLYPPWDKNLTTNDILVRIGKHFRAK
YERNKEKIVLLDKVIIHPKYNWKENMDRDIALLHLKRPVIFSDYIHPVCLPTKELVQRLM
LAGFKGRVTGWGNLKETWATTPENLPTVLQQLNLPIVDQNTCKASTRVKVTDNMFCAGYS
PEDSKRGDACEGDSGGPFVMKNPDDNRWYQVGIVSWGEGCDRDGKYGFYTHVFRLKKWMR
KTIEKQG
Download sequence
Identical sequences A0A1L1RV31
ENSGALP00000013544 ENSGALP00000013544 9031.ENSGALP00000013544

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]