SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013598 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013598
Domain Number 1 Region: 28-165
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-20
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 2 Region: 321-432
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000022
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 3 Region: 232-352
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000518
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013598   Gene: ENSGALG00000008359   Transcript: ENSGALT00000013613
Sequence length 556
Comment pep:known chromosome:Galgal4:3:3258573:3260939:1 gene:ENSGALG00000008359 transcript:ENSGALT00000013613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVALLLLLLQLLMLVTAVAGGEDAKVLCADTACYTLHRAELGWSAAQERCQNDGGNLAP
AGSRAEAERLEQLLADSMATSAWIGLRLERGHCVQSQEPLRGFSWAASGEPSNYSAWLAE
PHVTCLSTRCVALRPAGPHGPLGWVDRPCRATLPAFLCKFSFRGMCGPLRLGGPGQVSYE
TPFRVSSPTLGAAPFGTLAEVVCEGSVSSTFSVCKGQQEGDDFTWHPPGPICPNTCTHNN
GGCQQLCLEEPGKPSVCACRPNYVLGPDMASCLPEDPCHSNPCQGTCRPQPGGFECICEA
GYIVAPDGYRCVDVDECLEGPCKHECHNTAGSFFCSCQPGYQPAGPDGHDCRDEDECAQP
NACPQLCLNIAGSFRCLCKAGYQQQPGSDACLDIDECLRNPCPGPCRNLPGSFECICLPG
FLPQDDGHGCLTAPTTGEQLAGTMGTTAILQTASTAWTVGTPSPAAIPGGLAPPAPTVVV
SEHSPEHGADGPRLLLYYILGSLVAILLLLAFALALLACRKRASRQEKTKAKSAADNYCW
VPEQPESRSRAGSERR
Download sequence
Identical sequences E1BQ95
NP_001186380.1.86415 ENSGALP00000013598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]