SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013785 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013785
Domain Number 1 Region: 392-452
Classification Level Classification E-value
Superfamily BPTI-like 2.41e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0039
Further Details:      
 
Domain Number 2 Region: 268-327
Classification Level Classification E-value
Superfamily BPTI-like 4.26e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0034
Further Details:      
 
Domain Number 3 Region: 343-381
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 178-267
Classification Level Classification E-value
Superfamily PKD domain 0.0000000647
Family PKD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013785   Gene: ENSGALG00000008469   Transcript: ENSGALT00000013800
Sequence length 538
Comment pep:known_by_projection chromosome:Galgal4:5:23536721:23555298:1 gene:ENSGALG00000008469 transcript:ENSGALT00000013800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKQASKQTCLHSTRKGLRSEGGEDRGAEMARGRPSRQTGLWVCLVLVAGVVFGEEQETK
PFGETCLEDFTAGIPGLVLDTDASVQNGATFLSSPRVHRSRDCMRACCKDPDCNLALVEQ
APALGEDHIQGCFLLNCLYEQTFVCRFARKVGFLNFLKRDVYDTYHQAMQKHGSSDDRPP
IARTGMDMRVQPGESVMLRGTDSTDDHGIVAYEWKQILGDPSVEIKKLEKDQAEISNLQV
GTYVFQLTVTDTAQQQDFTNITIIVLNSEQTEEHCLTPKKVGWCRGSFPRWFYDPTLQQC
QEFIFGGCKPNKNNYLREEECKLACRNVKGSVSGRQMPVCNGNCQASSFRCKDGCCIDAY
LECDETPDCADGSDEVYCEQYAREFNRLQKINITRKQAHCVELPDTGQCTESIPRWYYNP
FSEKCDRFTYGGCDGNMNNFEEEEECMKSCSGVTKRDAIGRRWETFEPHSDTLSAFEVVI
AVLLGICIMVVLAIIGYFFLKNRRKSSRRRQPTTATNSTLSTTEDTEHLFYNGATKPV
Download sequence
Identical sequences ENSGALP00000013785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]