SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013830 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013830
Domain Number 1 Region: 158-318
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-45
Family MAM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 382-554
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.09e-33
Family MAM domain 0.0036
Further Details:      
 
Domain Number 3 Region: 6-110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-17
Family MAM domain 0.022
Further Details:      
 
Domain Number 4 Region: 559-597
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 341-382
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 119-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000013
Family LDL receptor-like module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013830   Gene: ENSGALG00000008498   Transcript: ENSGALT00000013845
Sequence length 599
Comment pep:known chromosome:Galgal4:2:18793459:18829474:-1 gene:ENSGALG00000008498 transcript:ENSGALT00000013845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFILKNSSSISQVAQLRSPKFRQTGSNCTMSFWYYNYGQSVGAAEMQLLVDGVDEPTVLW
RVYYNQGNQWLNSVIQLGRLLHPFQFSLNKISLGFYDGVSAIDDITFENCALPPPALSCE
GPNYFWCRDTKACISHLLVCDLVDDCGDGSDEDECNPDLQCDFENGLCNWAQDTEDDFDW
IRIQGPTPTVNTGPLKDHTTGTSMGHYLYMESSEPQEFEDKAVLLSPLLNPTYNRTCIFR
FHYHMSGKQVYTLSVFQRTMSNSKGILLWYKYGNQGGRWIRQTLYISSSKPFQVLVKGTV
GDGFTGDIGLDDLSFLDCALYNNGSLPTISTTLSGTSSPVTLPLNNCTENEFVCRASGHC
IHKIQKCNFRPDCSDKSDESDCAKEICNFEDNTQCGWYQPALKETPETDSITKMFKWELG
SGAKLYPGEEEHCASTDHTTYTEKGMYLFADSSNGEFGHSADIATPVISFTGPKCKITFW
NHMNGSTIGSLEVLSKTGNKTSTLWTQSGSQGPKWNRAEVFLGIRSDFQIIFRAKRGVSY
MGDVAVDDITFEDCSPLLIPDRPCTLEEFTCANKYCIPKDKLCDFVNDCADNSDENPAI
Download sequence
Identical sequences ENSGALP00000013830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]