SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013851 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013851
Domain Number 1 Region: 436-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000177
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 2 Region: 320-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000309
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 3 Region: 385-514
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000282
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 4 Region: 288-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000013851
Domain Number - Region: 361-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00117
Family EGF-type module 0.0043
Further Details:      
 
Domain Number - Region: 249-286
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0211
Family Integrin beta EGF-like domains 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013851   Gene: ENSGALG00000008514   Transcript: ENSGALT00000013867
Sequence length 683
Comment pep:known_by_projection chromosome:Galgal4:5:23697384:23706337:1 gene:ENSGALG00000008514 transcript:ENSGALT00000013867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRARRACGLTLLLVLLQQSASGSGVFQLKLHEFVNSRGALASGEPCAPHCRTFFRVCLKH
FQAVVSPGSCTFGSIITPVLGVNSFSIRDTERFDSPIKLPFNFTWPGTFSLIIQAWHAPA
NYLPQGSRPPPEEWLISQMAIQRSLAVGEVWSQDVQSSPLTQLRYSYRVVCSENYYGESC
SRLCKRRDDRFGHYVCEADGSLTCLPGWTGEYCTKPICLSGCAEQNGYCTKPGECICRSG
WQGRYCDECIPHIGCRHGTCKTQWQCICDEGWGGLFCDQDLNYCTHHRPCKNGATCMNTG
QGSYTCSCKPGFTGVDCEHEISECDSNPCRNGGSCTDMENGYRCVCPPGYYGAHCEHSAL
TCIDSPCFNGGTCLEKEQGASYTCVCPFGFTGSNCEKKVDRCTSNPCANDGNCFYLGQIR
VCRCRAGFSGQKCEININDCARSPCSNGGTCHDLINDYTCTCLPGYSGRNCDIKTRDECA
SGPCENGGTCYSGLYSANFVCYCPSGFMGSRCELPVYSVPITLPPKPVPWIAISMGVGLV
ALLILFCMIAMVIRQMRMQPQQDLETMNNLSDFQKDNLIPASQLKNTNKNKDLEVDCGLE
KSNYKPKNHKLDYNLVKDLTSRGTQEDKYYKSEKCLGEKSPLRLHSEKPECRISAICSPR
DSMYQSVFVITEERNECIIATEV
Download sequence
Identical sequences ENSGALP00000013851 XP_004941673.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]