SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013860 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013860
Domain Number 1 Region: 184-197,347-584
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-62
Family Nuclear receptor ligand-binding domain 0.0000617
Further Details:      
 
Domain Number 2 Region: 113-197
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.78e-32
Family Nuclear receptor 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013860   Gene: ENSGALG00000008519   Transcript: ENSGALT00000013876
Sequence length 596
Comment pep:known_by_projection chromosome:Galgal4:12:19731468:19749157:-1 gene:ENSGALG00000008519 transcript:ENSGALT00000013876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPSQRIQIISTDSSVGSPQRIQIVTDQQTGQKIQIVTAVDSSVSPKQQFILASPDGTG
AGKVILAAPETSNAKQLIFTTADNVVPGRIQIVTDSASVERLLGKADVQRAQVVEYCVVC
GDKASGRHYGAVSCEGCKGFFKRSVRKNLTYSCRSNQDCIINKHHRNRCQFCRLKKCLEM
GMKMESVQSERKPFDVQREKPTNCAASTEKIYIRKDLRSPLIATPTFVADKDGARSAGLL
DPGMLVNIQQPLIRDDGTILLAADSKAETSQGALGTLANVVTSLANLSDSLNNGDTSEIQ
QEEQSASEISRAFDTLAKALSTTDGTAVPNLADGMDPTGGGNIHVISRDQSTPIIEVEGP
LLTDTHVTFKLTMPSPMPEYLNVHYICESASRLLFLSMHWARSIPAFQALGQECNTSLVR
ACWNELFTLGLAQCAQVMSLSTILAAIVNHLQNSIQEDKLSGDRIKQVMEHIWKLQEFCN
SMAKIDIDGYEYAYLKAIVLFSPDHPGLNSSTQIEKFQEKAQMELQDYVQKTYPEDTYRL
ARILVRLPALRLMSSSITEELFFTGLIGNVPIDSIIPYILKMETAEYNGQITGTSA
Download sequence
Identical sequences A0A1D5PST3
ENSGALP00000013860 XP_004944783.1.86415 XP_004944784.1.86415 XP_015148654.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]