SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013904 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013904
Domain Number 1 Region: 403-533
Classification Level Classification E-value
Superfamily CalX-like 2.22e-36
Family CalX-beta domain 0.000000346
Further Details:      
 
Domain Number 2 Region: 533-626,662-723
Classification Level Classification E-value
Superfamily CalX-like 1.96e-30
Family CalX-beta domain 0.000000223
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013904   Gene: ENSGALG00000008544   Transcript: ENSGALT00000013920
Sequence length 953
Comment pep:known chromosome:Galgal4:3:15666219:15743112:1 gene:ENSGALG00000008544 transcript:ENSGALT00000013920 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQATHPPTFLVNFQLLSIVVVLLFHADGIHAESPSEVPANKSEVCTGSYICKKGVILPI
WEPQDPSFGDKIARATVYFVAMVYMFLGVSIIADRFMSSIEVITSQEREITIKKPNGETS
KTTVRIWNETVSNLTLMALGSSAPEILLSVIEVCGHGFTAGDLGPSTIVGSAAFNMFVII
AICVYVVPDGEIRKIKHLRVFFVTAAWSIFAYTWLYIILSVSSPGIVEVWEGLLTFFFFP
ICVVFAWIADRRLLFYKYVYKKYRAGKQRGMIIEHEGDRPSSKADIEMDGKVANSHVENF
LDGTLVLEVDEKDQDDEEARREMARILKELKQKHPDKEIEQLIELANYQVLSQQQKSRAF
YRIQATRLMTGAGNILKRHAADQARKAVSMHEVNSEVAENDPISKLYFEQGTYQCLENCG
TVALTIIRRGGDLTNTVYVDFRTEDGTANAGSDYEFTEGTVVFKPGETQKEIRVGIIDDD
IFEEDENFLVHLSNVRVSTEADEGILEASRVSTLACLGSPSTATVTIFDDDHAGIFTFEE
PVTHVSESVGTMEVKVLRTSGARGNVIVPYKTIEGSAKGGGEDFEDTCGELEFQNDEIVK
TISIKVIDDEEYEKNKTFYLEIGEPRLVEMSEKKALLLNELGGFTITGKLWKGKPVFRKV
QARERPLPCTVVTIREENEEKQPLTSKEEEERRIAEMGRPVLGEHTKLEVIIEESYEFKN
TVDKLIKKTNLALVVGTNSWREQFIEAITVSAGEDDDDDECGEEKLPSCFDYVMHFLTVF
WKVLFAFVPPTDYWNGWACFVVSILMIGILTAFIGDLASHFGCTIGLKDSVTAVVFVALG
TSVPDTFASKVAATQDQYADASIGNVTGSNAVNVFLGIGVAWSIAAIYHAAHGQSFEVSP
GTLAFSVTLFTIFAFISVGVLLYRRRPEIGAQQDGIPKHQHCLWVPNAASRDP
Download sequence
Identical sequences ENSGALP00000013904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]