SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000013965 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000013965
Domain Number 1 Region: 101-281
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.21e-42
Family CBM11 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000013965   Gene: ENSGALG00000008587   Transcript: ENSGALT00000013981
Sequence length 303
Comment pep:known_by_projection chromosome:Galgal4:5:23874242:23880206:-1 gene:ENSGALG00000008587 transcript:ENSGALT00000013981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVTLLNSTCLRSRCYRHKVLQPLLGTVCVDSVSKCSSSYRRPGSQPEVIPSWRNIDF
SFKKGFNALKTQLGLLKKETEDHLVGPDGHSFSQYLLEQTKVMWEFRTQEDLNKWVISSD
VEIGGKSEVYLKLGRNNQGAMLYGILNTEVPRDGETKYSGYCSMRAKPAVGSFARKKYYD
WSNFNCLYLRVRGDGRAWMVNIYTDPYFSHQKDDLYNYFMFTRGGPYWEEIKIPFSKFFL
SSRGRVQDDQHPIWLDKISTLGFTLGDKVDGPFQLEIDFIGLLNDRAHTEEFAYETYERN
PRI
Download sequence
Identical sequences E1BZH1
XP_004941675.1.86415 XP_421138.1.86415 9031.ENSGALP00000013965 ENSGALP00000013965 ENSGALP00000013965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]