SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014021 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014021
Domain Number 1 Region: 903-1191
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.79e-75
Family Protein kinases, catalytic subunit 0.000000288
Further Details:      
 
Domain Number 2 Region: 280-439
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.8e-21
Family MAM domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000014021
Domain Number - Region: 238-266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0183
Family LDL receptor-like module 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014021   Gene: ENSGALG00000008615   Transcript: ENSGALT00000014037
Sequence length 1455
Comment pep:novel chromosome:Galgal4:5:24001724:24083155:-1 gene:ENSGALG00000008615 transcript:ENSGALT00000014037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAAPAPLRVWVTAVVVVSCSGSHEVNSSAPIPPEKFSPIRNRMVSFLQPSEPEISCII
GSSCSWMTSTDSFGKPDWVLSSVSVLVSQERQQLLLENSSSQGGVEGDIFLLNTSRLPDR
CKFSLHSPILPGSVDSCLLELAVYSQDAVPVLQRFTVEIRYVDTNRNIIISLKVGHEEDA
GVKWNSMMAQIGRIERPFKITLLYSNCGAQEAGLLAVGSLQLRNCFHDKENPDLSIYNKG
SSFPCLHGGCVSHLQICEFISDCPTKEVEGMRCDSLPEGSHCSFEKGSCGWTLNETAASP
WSIKGFNDMIHSGSFVGSALQSTGGHFLYLRADSNHTNGMAKAFSTSLPASIATEDYQIQ
FSVHVFGSYNGTISFSVREERNGVPVTLPMWERAGSWSDHWFLITLPMPVLQNRFQLQLL
ATWGWNSQADIAIDNITFGMDCFADGRQPTHFKGKHQFPREISSPDEHLLNPLEEPSLPG
DTSVVLWWFSTCGASGPHGPTQAQCDNAYRGSNVSVIVEKEGRLRGVQVWRVPATNRYRI
SAYGAAGGKGAKNHNERSHGVFISATFQLEKDELLYILVGQQGEDACPGANPQTQKICLG
ESSVIEEDYKKKKDLKDWAGGGGGGGGATYVFRQKDGIFEPLLIAAGGGGKAYLKAQDNS
LDDVPLEQFENSTAVPGVSGRTGAAGGGGGWQDVTLLPQAGKSLLEGGEGGQACHQALAK
LQWATSGGFGGGGGACTSGGGGGGYRGGHASKNDDITAGGQYGISFVNPIGEIFLHPLAA
VENDGEVEVQIYLNCSHCHSDNCKRDPDTNLPVCQCEMGAVLANDNVTCTVPQGHVPEGH
LPLPLLLAVVAVIVMLGMILTGGSLSIIYHLKKQQLEGARARLQSPEYKLSKIRTSAIMT
DYNPNYCFAGKAATLSELKEIPRKNISLLRALGHGAFGEVYEGTVVGIAGDPSPLQVAIK
TLPEVCSEQDEMDFLMEALIISKFNHQNIVQCIGVSLQTLPRFILLELMAGGDMKSFLRQ
NRPRVNQPSVLTMQDLLNIARDIACGCKYLEENHFIHRDIAARNCLLTCTGAGRIAKIGD
FGMARDIYRASYYRKGGRAMLPVKWMPPEAFLEGIFTSKTDTWSFGVLLWEIFSLGYMPY
PCKTNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHSPEYRPNFSTILERIKYCTQDP
DVINTQLPMECSPTPEDEGNTVVRPSVPSGIVPLLVSPSLTPQMTPKSLDTHCTGHKLVQ
CPQELLVENLSNRTARGPSLPCLSDFNSASWIQNSNQKLEFSNPPTHRLKNKTKNLWNPT
YGSWVLENSCHLSPISKLKVTPEREDSGFDGNCSSSPSSRASPASPSRNNCPHLDIGGIE
LVKLQNFPCGNVNYAYDDLCFGTDHSPSVLTGVRAAVLRSSSLHTDEKPFYKTEKAARER
DSGLSLSDDLSVTPV
Download sequence
Identical sequences F1NLU3
ENSGALP00000014021 XP_004941681.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]