SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014032 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014032
Domain Number 1 Region: 251-404
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.28e-49
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00000746
Further Details:      
 
Domain Number 2 Region: 408-572
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.51e-44
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000214
Further Details:      
 
Domain Number 3 Region: 3-117
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-34
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 4 Region: 124-242
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-34
Family Spermadhesin, CUB domain 0.0000264
Further Details:      
 
Domain Number 5 Region: 616-774
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.53e-28
Family MAM domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014032   Gene: ENSGALG00000008621   Transcript: ENSGALT00000014048
Sequence length 881
Comment pep:known_by_projection chromosome:Galgal4:7:12175545:12233520:-1 gene:ENSGALG00000008621 transcript:ENSGALT00000014048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQPCGGRLNSKDAGYITSPGYPNDYPSHQNCEWVIYAPEPNQKIILNFNPHFEIEKHDCK
YDFIEIRDGDSEAADLLGKHCGNIAPPTIISSGSSLYIKFTSDYARQGAGFSLRYEIYKT
GSEDCSRNFTASNGTIESPGFPDKYPHNLDCVFTIIAKPKTEILLHFVLFDLEHDPLQAG
EGDCKYDWLDIWDGIPQVGPLIGRYCGTKMPSDIRSTTGVLSLTFHTDLAVAKDGFSAQY
YLIQQEVPENFQCNVPLGMESGRISNMQISASSTYSDGRWTPQQSRLNSDDNGWTPNVDS
NKEYLQVDLHFLTVLTAIATQGAISRETQNGYYVRTYKLEVSTNGEDWMMYRHGKNHKTF
QANEDATEVVLNKIHSPVLTRFVRIRPQSWHNGIALRLELYGCRITDSPCSNLLGMLSGL
IPDSQISASSIRGYDWSPSMARLVSSRSGWFPRIPQAQPGEEWLQVDLGVPKNVKGVIIQ
GARGGDSVTTTESRSFVKKFKVAYSMNGKDWEFIQDPKTMQAKLFEGNIHYDIPEIRRFD
PVPAQYVRVHPERWSPAGIGMRLEVLGCDWTDVKPTAETLVPTLKSEETTTPYPTDEEAT
ECGDSCGEEEDFHLPANFNCNFDLPEDLCGWSHDSATGYTWSFQPASTWMGNSEPSPETL
PDAKSYLRLQSSGRRESQRARLISPTIYLPRSAVCMVFQYQVWGSSGVMLRVWREASQEH
KALWVIAEDQGKEWREGRIILPSYDMEYRIVFEGFIRNGHAGELALDDIRLGNDIPLEYC
MEPITAFPGATLLPGTEPTVDTVSVQPIPAYWYYVIAAGGAVVVLVSVALALVLHYHRFR
YAAKKSDHSITYKTSHYANGAPVAVEPTLTIKLEQDPSSRC
Download sequence
Identical sequences ENSGALP00000014032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]