SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014044 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014044
Domain Number 1 Region: 81-222
Classification Level Classification E-value
Superfamily C-type lectin-like 3.81e-35
Family C-type lectin domain 0.00034
Further Details:      
 
Domain Number 2 Region: 361-501
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-33
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 3 Region: 230-358
Classification Level Classification E-value
Superfamily C-type lectin-like 7.01e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 16-75
Classification Level Classification E-value
Superfamily C-type lectin-like 3.15e-16
Family C-type lectin domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014044   Gene: ENSGALG00000019667   Transcript: ENSGALT00000014060
Sequence length 589
Comment pep:known chromosome:Galgal4:2:19344174:19359528:-1 gene:ENSGALG00000019667 transcript:ENSGALT00000014060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGACLATIFPFFNFSWLGKTPVNYVAWAPGEPNYSHNDENCVVMKEDFGFWNDINCG
LKNTFICERRNSTYSGFVPTVLPPLGGCPEMWILFQNKCYKIVGSREEERLTWYSARSAC
IEQGGNLASIHNAQVQAFLTFHLKDVTDETWIGLNDKHSYIWTDGSPYDYACWARGFPLG
KYNRVGWKTDCIAMMIRSVNEAGKWENTDCHHNKSYICQMDSKPELFHSTTAPDSDFLHY
GNSSYLIIPSKMSWEEARKACREKSSELASISDYYSNIFLLLQAAQYGEPLWIGINSNLS
YGYYRWSDKRKIDFSNWHYEEPKEKIACVFLELSGEWKTAPCNEKHFSVCKKSEGILPSD
PPQDIGRCPQSGHIAWIPFRSHCYYFNPSEMSWVQSVTQCIQSGGMLTSVVDLAESNFLE
EHADLYTSKTSGFWIGLYRNINGQLLWQDNSVLDFVNWGEAEPLEEQHENEYCVQLSASS
GSWNSIPCSSRKGFICKTPKTIPEAVANVKGGRKDNDQSTVWILLILVLVILVGMGFMVY
FFFKIKIQSEAERAVGQQSMLLEYSSALDRENDENDPASSKGGSERSDV
Download sequence
Identical sequences ENSGALP00000014044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]