SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014090 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014090
Domain Number 1 Region: 25-94
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000251
Family Fibronectin type I module 0.052
Further Details:      
 
Domain Number 2 Region: 154-198
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014090   Gene: ENSGALG00000008661   Transcript: ENSGALT00000014106
Sequence length 306
Comment pep:known chromosome:Galgal4:8:15135794:15137430:-1 gene:ENSGALG00000008661 transcript:ENSGALT00000014106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CDHTKGLECNFGASPAATNGICRAQSEGRPCEYNSKIYQNGESFQPNCKHQCTCIDGAVG
CIPLCPQELSLPNLGCPSPRLVKVPGQCCEEWVCDESKDALEELEGFFSKEFGLDASEGE
LTRNNELIAIVKGGLKMLPVFGSEPQSRAFENPKCIVQTTSWSQCSKTCGTGISTRVTND
NPDCKLIKETRICEVRPCGQPSYASLKKGKKCTKTKKSPSPVRFTYAGCSSVKKYRPKYC
GSCVDGRCCTPQQTRTVKIRFRCDDGETFTKSVMMIQSCRCNYNCPHANEAYPFYRLVND
IHKFRD
Download sequence
Identical sequences ENSGALP00000014090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]