SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014150 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014150
Domain Number 1 Region: 1517-1629
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-38
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 2 Region: 938-1047
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.05e-36
Family Spermadhesin, CUB domain 0.00017
Further Details:      
 
Domain Number 3 Region: 592-704
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-36
Family Spermadhesin, CUB domain 0.00058
Further Details:      
 
Domain Number 4 Region: 2700-2811
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-35
Family Spermadhesin, CUB domain 0.00022
Further Details:      
 
Domain Number 5 Region: 2238-2346
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-35
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 6 Region: 1398-1512
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-34
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 7 Region: 1060-1163
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.93e-34
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 8 Region: 711-821
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.63e-34
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 9 Region: 2462-2575
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-34
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 10 Region: 1174-1283
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-34
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 11 Region: 3165-3289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-33
Family Spermadhesin, CUB domain 0.00031
Further Details:      
 
Domain Number 12 Region: 1750-1861
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-33
Family Spermadhesin, CUB domain 0.00041
Further Details:      
 
Domain Number 13 Region: 3046-3159
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-31
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 14 Region: 1644-1746
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 15 Region: 3405-3517
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.00032
Further Details:      
 
Domain Number 16 Region: 1998-2101
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.23e-30
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 17 Region: 1292-1397
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 18 Region: 1870-1975
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-29
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 19 Region: 2346-2456
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.79e-29
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 20 Region: 470-586
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-28
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 21 Region: 3521-3634
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-28
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2102-2223
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-28
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 23 Region: 831-932
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-27
Family Spermadhesin, CUB domain 0.00071
Further Details:      
 
Domain Number 24 Region: 2581-2697
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-26
Family Spermadhesin, CUB domain 0.00082
Further Details:      
 
Domain Number 25 Region: 2926-3045
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-25
Family Spermadhesin, CUB domain 0.00037
Further Details:      
 
Domain Number 26 Region: 3296-3405
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 27 Region: 2815-2928
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-22
Family Spermadhesin, CUB domain 0.00089
Further Details:      
 
Domain Number 28 Region: 433-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000113
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 29 Region: 132-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000168
Family EGF-type module 0.012
Further Details:      
 
Domain Number 30 Region: 303-361
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family EGF-type module 0.01
Further Details:      
 
Domain Number 31 Region: 352-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000643
Family EGF-type module 0.047
Further Details:      
 
Domain Number 32 Region: 392-434
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000175
Family EGF-type module 0.039
Further Details:      
 
Domain Number 33 Region: 132-265
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000022
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000014150
Domain Number - Region: 263-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000636
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014150   Gene: ENSGALG00000008704   Transcript: ENSGALT00000014166
Sequence length 3634
Comment pep:known_by_projection chromosome:Galgal4:2:19737380:19876287:1 gene:ENSGALG00000008704 transcript:ENSGALT00000014166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWAAPSPGLLVALLLLAGLSCESNHYEKKRQKRNIYDEQPRLSSEQGNLVFHAGSSKNI
EFRTGPLGKIKLNEEDLAEMFSQMRENKAEIQELKKASGVSQNVSHQVSMLASKVTSLDM
KLQSLEQTLQRKACSSNPCENSGTCVNSLDGFFCLCPSNWRGLRCSEDINECQIYAGTAL
GCQNGATCVNTPGSYSCSCTPETYGPRCASKFDDCQGGSQTLCEHGTCVDAERDTPNKPK
YHCICDTGWMSPPGSPACSADIDECSLPNPPCSQNPRVQCHNTLGSYSCDPCPTGWQGNG
YSCQDIDECESDNGGCSTAPMVQCINTIGSFRCGVCPPGYEGDGQTCTQVDSCSINNGGC
HPSATCTSTPGLMPFCSCSPGYTGSGYGPNGCSPLTDICQLQNPCANGQCLAVTSGYFCL
CNAGWTGSNCTENIDECISNPCQNGGSCTDGVNGYTCECTSAWTGPQCQTAQQACGGYLS
GSRGTFSYPNNPSSQHYDTGVSCAWVIQTASNKILHITFPFFHLEASTDCNSDFLQIHDG
ASASMHMLGKYCGSNPPAELFSSHNSLYFWFHSNHAVTAGGFTVQWDSRDPECGGELTAT
YGSISSPGYPGNYPVNRDCFWTISTNPGLLITFAFGTLSLEHHENCSYDYLEIRDGLLSQ
DSVLGKYCSTGSPPPLQTTGPYAWIHFHSDDEVTDKGFHIVYTTSAADPTCGGNYTDSEG
VITSPFWPNSFINSQQCIYIIRQPEDEKIHLNFTHLELESHAGCSLNYIEVRDGDSEMSS
LITRFCHSTVISPITSTSNSLWIKFKSDASVQRASFRAVYQVACGGSLSGEGTIHSPYFP
RMSSQPKTCEWIISQSVSKVVILNFIDFDIRNTTTCDSDYVEVRDGNNTESPLLGKYCGT
AVPSRVQSTRNNLYIKFRASSLTNLGFRAQYWPLDTVCGESLTGSEGTITSPGFPDVYPH
GINCIWTINVQPGYLIRLTFTSFNLPFHSSCRMDYLEIYDNSTMQKLGRYCGRSIPPSLT
SGGNVMMLYFVTDRSISSEGFSANYISLDASKVCSHNYNTETGVLTSPNYPNNYPVQTEC
IYTITVGINRQIVLRFTNFTLEGNLRCTEDYIEIRDGGYETSPYLGKYCGSGLPPVIISH
GNKLWIKFVSDIFGTRKGFSAEWDGTSAGCGGTLTTSSGIFMSPNYPMPYYHSSECYWLL
RGSRGTPFEIQFEQFHLEYHPNCNFDYLAVYDGNSSNAKQLGKFCGNQIPQFINSSGDSV
YIKLRTDSSVHGGGFLAKYKQVCHEVLTVNRSYGVLESLNYPNNYPLGEHCRWTIQTTKG
NTLSYSFTAFDVEDGSNCDRDYLKLYDGPNVQSNLIGTFCGQSLPLAGNSTGTSLHVEFY
SDGLQARSGFQMLWHTNGCGGELSGPSGSFHSPGYPNRYPSNRECIWYIQTTPGSSIQLT
IQEFDVEYHPNCNYDVLEVFGGPDFLSPRLAQLCISRSAQNPLLLSTTGNSAVVRFKTDE
AVTGKGFSASWQENLHGCGGIFQANSGEIHSPNYPEPYSNNTDCSWLIQVDYSHRVLLNF
TDFDIEDHRLCNYDNVTVFDGPSNEAPLLRVLCGTQHPSPITSSRNQMYVRLRSDRTFQH
RGFSARFSEACGSFIESDSVGAAISSPLYPAKYPNNQNCSWIIQAQEPFNHVTLSFTDFD
IENNRQNCTTDFVEILDGNNYDAPLQGRYCGTNMPHPITSFGNALVVNFISNNNITTRGF
HATYAASSSSCGGTFHMDRGAFNSPGYPESYPLNTECVWTILSSPGNRLQLSFTAFQVES
SSGCTKDYLEIREGNATGTLAGKFCGDSLPSNYTSTVGHILWVKFVSDSSGTDVGFRATF
SHLYGNDIVGNRGQIASPQWPRSYPHNSNYQWRISTNASQVIHGRILEMDIENHYRCYYD
KLKVYDGPTIHSRPIATYCGADPASFASSGSTLTIQFQSDSSVTGRGFLLEWYAMEPSAP
TRTIARGACGGTVTSEETPSFLYSPGWPLNYRNFADCVWLIRAPGSTVEFNILALDIESH
SSCYYDRLTIQDGDNGLSPLLATICGREPPGPVRSTGETMFIRFVSDGSVTGAGFNASYH
KSCGGYLHADRGVITSPSYPQEYTPNLNCSWHVLVTSGYIITVHFEQPFQVKSEDASCNS
GDYVELKNGLDASAPPLVSGRGNGRFCGSSPISTMYTTDNQLFVHFISDSRNEGQGFKLK
YEAKSLACGGNIYISDFNPSGYTSSPNYPNNYPSHADCVWTITAPNGHAVELQFEDQFYI
EPSPNCTSSYLELRNGADSSAPVLAKLCGSLLPGSQRSSGAVMYLRFRSDSSSTHVGFNA
KYSIAPCGGTVAGRSGVIESVGYPDLHYPDNLLCEWFLQGPRGHYLTITLEDLDIQNTSE
CASDFVEIREYNASGNLLGRYCGNTLPDAVDTSDSFAYVKFVADGSINARGFRLRFDSST
EECGGDFSAPVGMFTSPNYPNRYPHNRVCEWRITVEEGRRVILTINDMRTEEHWRCSSDY
VAVYNGLRQNSPRLVKLCGEVNPGTEVKSSGNTMKVVLVTDMTHATRGFSVSYTSNEDSV
CGGTLMGYTGGNFSSPGYDGVKNYTSKLNCEWTIENPSHYNSSIYISFEDFHLEHHQDCQ
YDYLELRIGDADGELIARLCGQAAPSVPLVIAAPQVWIHFVSDENTEDKGFLGRYIFEAC
GGIQSGERGFISSPNYPEPYGNLNHCSWLLEAPEGETITLNFTAFHVENHSLCKWDSVTI
LNGGSPGSPVIGRYCGNTSPGIIQSGSNKLLVIFNSDRSIQGGGFYATWTAESLGCGGII
HSDSGMIKSPHWPQNFPMNTRCTWTIITHESKHLEMIFHNNFQIPHSDGSCQSSFVKVWQ
GNHEEEEALLATGCGTSAPDPVIAPNNIVTTVFQSRDAPGRGFSASFISRCGINFTSPAG
RIVSPNYPSQYDNNLNCSYIIDRGPQSLVILEFETFHLEAPALLSRICLYDGVSIFRGTR
VTPHPVITLCGSEVPEPISVFGPMLLNFYTDSHIAGFGFQARYRTIACGGTFSGSVGIIS
SPAHSVLDYHNNMNCSYHITVGSGKAVVLKFNTFQLELSPSCYKDSVAVYDGSDTHAPLL
GKFCGSELPPNMKSSSNQLFLVFNTDFSGSDRGWKASFRETLGPQDGCGGYLTYSAYSFG
SPVSNVSGRYERNLDCVWVITAPVNKLINLTFTSFVLEAHVAQTCQYDYVKLYDGGNENA
NLVGTFCGSIVPAPFLSTSNSLTLKFVTDNSVQREGFSATYTTVDRLCGGTYNATSTSLT
ATSPNFPSEYPPFTLCTWVIDAPPQQQVKVVVETFHLHPSQDCSQNYLQLQDLPMHSQGS
THRFCGNETFPVPEFYSHDRTAIVTFKSDEYRINNGVRFTYQATGCSREYNQPFGYLKSP
GWPGRHPNNMDCSIVLKAPLNHTISLFFHAFSLEDSIQCSHDFLEVRNGSNMQSPLLGRF
CGNTVPSPIFPQSHVVFLRFKSDVSGAHDGYEITWTSSSSGCGGTLYGSTGTFASPRFPA
TYWNNTHCEWVITVPKGRIVTVNFDFISIDDPGDCSSNYLILYNGPDTSYPQAGPYCGMD
TNIAPFTATSHQVYVKFHAEYVTLPSGFRLSWTS
Download sequence
Identical sequences F1NIW7
XP_001235156.3.86415 ENSGALP00000014150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]