SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014198 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014198
Domain Number 1 Region: 119-465
Classification Level Classification E-value
Superfamily Subtilisin-like 6.81e-82
Family Subtilases 0.00000000852
Further Details:      
 
Domain Number 2 Region: 459-605
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.68e-43
Family Proprotein convertase P-domain 0.0000877
Further Details:      
 
Domain Number 3 Region: 35-107
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000000408
Family Prohormone convertase 1 pro-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014198   Gene: ENSGALG00000008734   Transcript: ENSGALT00000014214
Sequence length 644
Comment pep:known_by_projection chromosome:Galgal4:3:11382922:11480137:-1 gene:ENSGALG00000008734 transcript:ENSGALT00000014214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGPPPLLLRGAFVLLLLVLLLLSLGAPARAAVYTNQFLVELHSGDQAEAERVAADHGF
GGVRKLPFLDTGYYFYHNGIAKVRRRRSFQHKLHLEKDSRVKKAVQQEGFSRRKRGYRDI
NDIDINMNDPLFTKQWYLINTGQADGTPGLDLNVAEAWELGYTGKGVTIGIMDDGIDYLH
PDLASNYNAQASYDFSSNDPYPYPRYTDDWFNSHGTRCAGEVSAAANNNICGVGVAYNSK
VAGIRMLDQPFMTDIIEASSISHMPQVIDIYSASWGPTDNGKTVDGPRELTLQAMADGVN
KGRGGKGSIYVWASGDGGSYDDCNCDGYASSMWTISINSAINDGRTALYDESCSSTLAST
FSNGRKRNPEAGVATTDLYGNCTLRHSGTSAAAPEAAGVFALALEANLDLTWRDMQHLTV
LTSKRNQLHDEVHRWRRNGVGLEFNHLFGYGVLDAGAMVKMAKDWKTVPERFHCVGGSIQ
EPEKIPPSGKLVLTLTTDACEGKENFVRYLEHVQAVITVNSTRRGDLNINMTSPMGTKSI
LLSRRPRDDDSKVGFDKWPFMTTHTWGEDPRGTWVLEIGFVGGVPQRGVLKEWTLMLHGT
QSAPYIDQIVKDYQSKLAMSKKEELEEELDEAVERSLKSILSKN
Download sequence
Identical sequences XP_004940271.1.86415 ENSGALP00000014198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]