SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014237 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014237
Domain Number 1 Region: 26-350
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.32e-125
Family Bee venom hyaluronidase 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014237   Gene: ENSGALG00000008761   Transcript: ENSGALT00000014253
Sequence length 516
Comment pep:known_by_projection chromosome:Galgal4:1:21866991:21875891:-1 gene:ENSGALG00000008761 transcript:ENSGALT00000014253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFTILLVSCCSSLNMRARPLLSNSPFLSIWNAPTELCTERTGVQLDMSFFPLTGSTLKT
SIGQNITLFYPDRLGYYPYKNEVTGEAFNGGLPQLALLENHLKKAKEDIQFYIPSDEQFG
LAVIDWENWRPVWIRNWGSKDIYRQESIELVQQRDISLSEAEARTIAKKEFEAAAKSLML
ESLKLGIAMKPNRLWGYYLYPDCYNYDYKQNPHNYTGTCLDIEIARNNELNWLWEKSTAL
YPSVYLETALRSSRNAQLFVRNRVQEAIRVSYVSNSTHPLPVFVYTRPVFTDLYEEYLSQ
DDLVNTIGESAALGASGIVIWGDMNLTQSKNTCRTLDNYLRKTLTPYLINVTMAARICSQ
VVCQDSGACARKKWNSNDYLHLNPENIAIRMTKDGKYTLQGQPAFQDLQTFIEKFDCHCY
AGHNCEPRVDISDIHYLRACISEEICIQISSNSFSNIDSSKEKNLSNRTVFPLASQSKDL
DLAYCVAYCGTPKDIGTFTGDDCWVSQNLNASGITD
Download sequence
Identical sequences F1NRQ3
ENSGALP00000014237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]