SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014662 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014662
Domain Number 1 Region: 435-564
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000455
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 626-668
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000461
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 3 Region: 728-854
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000062
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 4 Region: 371-414
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000186
Family EGF-type module 0.007
Further Details:      
 
Domain Number 5 Region: 660-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000324
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 6 Region: 334-372
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000143
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 7 Region: 295-338
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000191
Family EGF-type module 0.011
Further Details:      
 
Domain Number 8 Region: 705-739
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000122
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGALP00000014662
Domain Number - Region: 590-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000382
Family EGF-type module 0.067
Further Details:      
 
Domain Number - Region: 183-342
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0487
Family Growth factor receptor domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014662   Gene: ENSGALG00000009020   Transcript: ENSGALT00000014678
Sequence length 1216
Comment pep:known_by_projection chromosome:Galgal4:3:12844082:12878172:1 gene:ENSGALG00000009020 transcript:ENSGALT00000014678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAARRAAARSLVLFLALLGLRAQVASASGQFELEILSVQNVNGVLQNGNCCDGTRNPGD
KKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSKSTPVIGGNTFNLKYSRNNEKNRIVIP
FSFAWPRSYTLLVEAWDYNDNSTNPDRIIEKASHSGMINPSRQWQTLKHNTGAAHFEYQI
RVTCAEHYYGFGCNKFCRPRDDFFTHHTCDQNGNKTCLEGWTGPECNKAICRQGCSPKHG
SCTVPGECRCQYGWQGQYCDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYCGTH
PPCLNGGTCSNTGPDKYQCSCPEGYSGQNCEIAEHACLSDPCHNGGSCLETSTGFECVCA
PGWAGPTCTDNIDDCSPNPCGHGGTCQDLVDGFKCICPPQWTGKTCQLDANECEGKPCVN
ANSCRNLIGSYYCDCITGWSGHNCDININDCRGQCQNGGSCRDLVNGYRCICSPGYAGDH
CEKDINECASNPCMNGGHCQDEINGFQCLCPAGFSGNLCQLDIDYCEPNPCQNGAQCFNL
AMDYFCNCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAVASNSTPEGVRYISSNVCGPHG
KCKSQAGGKFTCECNKGFTGTYCHENINDCESNPCKNGGTCIDGVNSYKCICSDGWEGTY
CETNINDCSKNPCHNGGTCRDLVNDFFCECKNGWKGKTCHSRDSQCDEATCNNGGTCYDE
GDTFKCMCPAGWEGATCNIARNSSCLPNPCHNGGTCVVSGDSFTCVCKEGWEGPTCTQNT
NDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEINGYR
CICPPGRSGPGCQEVTGRPCFTSIRVMPDGAKWDDDCNTCQCLNGKVTCSKVWCGPRPCI
IHAKGHNECPAGHACVPVKEDHCFTHPCAAVGECWPSNQQPVKTKCNSDSYYQDNCANIT
FTFNKEMMAPGLTTEHICSELRNLNILKNVSAEYSIYITCEPSHLANNEIHVAISAEDIG
EDENPIKEITDKIIDLVSKRDGNNTLIAAVAEVRVQRRPVKNKTDFLVPLLSSVLTVAWI
CCLVTVFYWCIQKRRKQSSHTHTASDDNTTNNVREQLNQIKNPIEKHGANTVPIKDYENK
NSKIAKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDRDEKPPNSTPTKHPNWTNKQDN
RDLESAQSLNRMEYIV
Download sequence
Identical sequences XP_015139015.1.86415 XP_415035.4.86415 ENSGALP00000014662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]