SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000014686 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000014686
Domain Number 1 Region: 668-960
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.61e-75
Family Protein kinases, catalytic subunit 0.00000027
Further Details:      
 
Domain Number 2 Region: 55-212
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000586
Family MAM domain 0.049
Further Details:      
 
Domain Number 3 Region: 15-47
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000014686   Gene: ENSGALG00000009034   Transcript: ENSGALT00000014702
Sequence length 1201
Comment pep:known_by_projection chromosome:Galgal4:3:8094160:8384451:1 gene:ENSGALG00000009034 transcript:ENSGALT00000014702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNCTTGAASVSKMALEGSFSCWNGTSIRLGQACDFIRDCTEGEDEGAMCRKLPSGFYCS
FEEGDCGWMEGSAASRASPWRIGSLEYNRFPSVADYALILDTNKAPAGASTVMTSATFPT
PLRNSPCELRMSWLIRGVLLGNISLVLVENKTGKELSRTFWHSANSEGLGIWQWLILPLP
DILDRFWFQIIASWERGSNAVIAFDNVSLSLDCFLTINGEKITRSSTPDSSNLLTSRRAH
DLKIGRNQSKQMAIMDMQDHWLFTTCGASGAYGPTQSQCNDAYRNSNLSVIVGAEGILQG
IQIWRVPATNTYSISGYGAAGGKGGKNTMVRSHGVSVLGIFDLQKDDTLYILVGQQGEDA
CPSTNDVIQKVCIGENNVIEEEIRVNRSVNEWAGGGGGGGGATYIFKMENGEPVPLIIAA
GGGGRAYRAKTDTFHPERLENDSSVPGLNGNSGAAGGGGGWNDNTSFLWSGKSLLEGATG
GRSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAAEDNDPEMDGEDGVSFINPI
GTLYTPALKVTEGHGEVDIRLHLNCSHCEMDECRVDLETQKVICFCEPGTDLAEDGVSCI
GAPAEPTVHLPLSLVLSVVTSALVAALILAFSGIMIVYRRKHQELQAMQMELQSPEYKLS
KLRTSTIMTDYNPNYCFAGKTTSISDLKEVPRKNISLIRGLGHGAFGEVYEGQVAGIPSD
PTPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAG
GDLKSFLRETRPRPNQLSSLSMLDLLHVAHDIACGCQYLEENHFIHRDIAARNCLLTCRG
PGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWE
IFSLGYMPYPSKSNQEVLEFVTNGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILE
RIEYCTQDPDVINTALPVEYGPSIEEEEKVAIRPEDPEGIPPLLVSSHQDKKDDKQTLPS
PPPLPSAITAGKALGKAGSLELSVPGKVQAASGGGHINMAYAQSNPPSELHKSRGSRNKP
TNLWNPTYGSWFAEKQASKNKPLLEKEMPERENLGHEGNCTVGPNIVTGRLPGSSLLLEP
SSLTASVKEVPLFRLRHFPCGNVNYGYQQQGLPLEASTPPCATSYEDPALRNKNHISQQG
P
Download sequence
Identical sequences ENSGALP00000014686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]