SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015140 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015140
Domain Number 1 Region: 1126-1212
Classification Level Classification E-value
Superfamily Immunoglobulin 9.34e-21
Family I set domains 0.043
Further Details:      
 
Domain Number 2 Region: 1041-1120
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 736-793
Classification Level Classification E-value
Superfamily BPTI-like 5.82e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 4 Region: 906-988
Classification Level Classification E-value
Superfamily Immunoglobulin 3.49e-17
Family I set domains 0.025
Further Details:      
 
Domain Number 5 Region: 416-477
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000249
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 363-421
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000034
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 7 Region: 23-76
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000445
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 8 Region: 301-357
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000419
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 9 Region: 482-538
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015140   Gene: ENSGALG00000009315   Transcript: ENSGALT00000015156
Sequence length 1275
Comment pep:known_by_projection chromosome:Galgal4:5:25589641:25615991:-1 gene:ENSGALG00000009315 transcript:ENSGALT00000015156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFCFIFIVYICCFPYGHRMKRQTGVWGSWGEWGKCSRSCGGGVSVRQRHCYFQRTESASS
CIGPTRSYRSCNIQSCPEGSRDFRAEQCAEFDGTEFQGKKYKWLPYYGAPNKCELNCIPK
GENFYYRHKETVIDGTTCEPGKRDICVEGVCQAVGCDNILESTKKEDKCLQCGGDNSTCY
DVKGTFDVPNLPKGYNQIFIIPVGATSIQIKEVMPSRNFMAVKNVQGDYYLNGHWTIDFS
RTLHIASTVMHYDRGSEGDLAPELLHARGPTTEPLVIELISQEPNPGVQYEYYLPMHRQT
TGYSWSYSSWSECSSECGGGFQTRLVFCTIDNEIYPDYMCRNKPQPDNNRTCGHQTCPQT
KRWKTGEWGPCSATCGGGTQTRSVYCVAFDGQNSQGVVDNAECMAFAQQPHSSQPCNRRQ
CATWSTGPWSECSASCGEGVQTRTVTCRTQHGSQAQDFACLMEPKPPATQPCLKENCIQE
VGWHVGDWGLCSKSCNSGIRTRQVICADGDSKFYSADICKAIQPQKPATLGSCNVQPCYL
PQQVPSMQDTMGYDTSRRSLLTRYNPDSPPTGSEGTEPEEPQSNQIQKQGPEDAYSGETL
IQKNLPCITQYPTTGTGSQNCYQTPHGCCPDGHTPASGPLGRGCSFNTCHQNRYGCCPDG
VSAARGPNNMGCPQYDSDVHMRRNQPAAAVPTASQALSQQHPSGECRSSVYGCCFDNVAS
ASGPEGEGCLNRPNYPYPVMCLLPSAHGPCANWTTRWYFVTVVGKCNRFWYGGCHGNKNS
FASEEECMRVCHSSVGGKQQPLPGESSSHGQEGRAYGASHRTQNRHGENYWRRQVLPETL
QRSSVMESQQWGTQQRETAVPGSSQKLSSSGQQVLPREAPSLSRPAFAVGVPVIPFSFRA
ILEEAKPSLVTAIMGQNIQLVCKASLSPFSRVEWMKDGRPVSSDRHTYQSDSSLVISHVK
LEDAGTYTCLISDGRTESRRQIQLQIVEYQSAVLAEGERGQVLHKENQRQRELPRGGKVI
QAAGSSVHPQFTYRLRMDKSEPSVVEAKVGERVRLPCTVEASPALTIEWQKDGQPLSPPR
HRQQSDGALVISRVSSEDAGFFTCIASNGRDQDQRQVLLRPLGGLRITGLLPSIKVSEGE
TAQLHCTVTGNNVNIRWSRNGVPVRADGRHIHLSQDGSLIISNIQLADEGSYTCSAYSSS
NSVSASTEVKVLRSRPSTTVNHVVDLNRECVDQPHLANCGLIVQAQLCGNEYYASFCCAS
CSRYQPHASPPHRSG
Download sequence
Identical sequences ENSGALP00000015140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]