SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGALP00000015259 from Gallus gallus 76_4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGALP00000015259
Domain Number 1 Region: 54-161
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 2 Region: 236-339
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 5.64e-20
Family Platelet-derived growth factor-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGALP00000015259   Gene: ENSGALG00000009378   Transcript: ENSGALT00000015275
Sequence length 345
Comment pep:known chromosome:Galgal4:4:20652981:20768790:1 gene:ENSGALG00000009378 transcript:ENSGALT00000015275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGLLLLTSALAGRRHGAAAESDLSSKFSFPGAKEQNGVQDPQHEKIITVTSNGSIHS
PKFPHTYPRNTVLVWRLVAVDENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTVL
GRWCGSSSVPSRQISKGNQIRIRFVSDEYFPSQPGFCIHYTLLVPHHTEAPSPSSLPPSA
LPLDVLNNAVAGFSTVEELIRYLEPDRWQLDLEDLYRPTWQLLGKAYIHGRKSRVVDLNL
LKEEVRLYSCTPRNFSVSLREELKRTDTIFWPLCLLVKRCGGNCACCHQNCNECQCIPTK
VTKKYHEVLQLKPRSGVRGLHKSLTDVPLEHHEECDCVCKGNSEG
Download sequence
Identical sequences Q9I946
9031.ENSGALP00000015259 ENSGALP00000015259 ENSGALP00000015259 NP_990052.1.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]